8URV: Pro-IL-18

Solution NMR structure of pro-IL-18. Determined by solution NMR. Released 29 May 2024.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,562
Mol. weight: 22.35 kDa
Released: 29 May 2024

Explore 8URV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8URV contains 7 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	10-19	10	1
β-strand	22-27	6	1
α-helix	33-35	3
α-helix	37-39	3
β-strand	45-48	4	1
β-strand	55-57	3	2
α-helix	63-69	7
α-helix	79-81	3
β-strand	82-85	4	2
β-strand	97-98	2	1
β-strand	100-103	4	2
β-strand	107-111	5	2
α-helix	113-115	3
β-strand	118-120	3	2
α-helix	123-125	3
α-helix	133-135	3
β-strand	137-142	6	1
β-strand	145-153	9	1
β-strand	159-165	7	1
β-strand	170-176	7	1
β-strand	185-190	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-18	A	protein	193	Homo sapiens	Q14116 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8URV_1 Interleukin-18 (chains A)
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
GDRSIMFTVQNED

Primary citation

Structural transitions enable interleukin-18 maturation and signaling. Dong, Y., Bonin, J.P., Devant, P. et al. Immunity (2024) 57:1533. DOI 10.1016/j.immuni.2024.04.015 · PubMed

Other PDB entries of the same protein (UniProt Q14116 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VXT 1.49 Å, Crystal structure of human IL-18 complexed to murine reference antibody 125-2H Fab
9OD9 1.6 Å, Structure of disulfide-stabilized IL-18 variant
4EKX 1.75 Å, Crystal Structure of YLDV 14L IL-18 Binding Protein in Complex with Human IL-18
7AL7 1.8 Å, The Crystal Structure of Human IL-18 in Complex With Human IL-18 Binding Protein
9OD7 1.9 Å, Structure of disulfide-stabilized IL-18 variant
4XFS 1.91 Å, Structure of IL-18 SER Mutant I
3F62 2.0 Å, Crystal Structure of Human IL-18 in complex with Ectromelia virus IL-18 Binding Protein
4XFT 2.0 Å, Structure of IL-18 SER Mutant III
4HJJ 2.1 Å, Structure Reveals Function of the Dual Variable Domain Immunoglobulin (DVD-Ig) Molecule
3WO2 2.33 Å, Crystal structure of human interleukin-18
4EEE 2.71 Å, Crystal Structure of YLDV 14L IL-18 Binding Protein in Complex with Human IL-18
4R6U 2.8 Å, IL-18 receptor complex

Browse structure collections

About this viewer

MolViewer shows 8URV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.