8VAV: PDB entry 8VAV

Human Slo1 - human LRRC26 in presence of EDTA - GR masked. Determined by electron microscopy at 3.13 Å resolution. Released 25 Dec 2024.

Method: Electron microscopy
Resolution: 3.13 Å
Organism: Homo sapiens
Chains: 8
Atoms: 18,532
Mol. weight: 680.65 kDa
Ligands: POV, AJP, CLR, NAG
Released: 25 Dec 2024

Explore 8VAV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8VAV contains 80 α-helices and 64 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	22-45	24
α-helix	94-104	11
α-helix	110-133	24
β-strand	139-141	3	1
α-helix	149-169	21
α-helix	174-178	5
α-helix	181-199	19
β-strand	201-203	3	1
α-helix	208-216	9
α-helix	217-222	6
α-helix	230-259	30
α-helix	274-285	12
α-helix	298-326	29

Chains E, F, G and H: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	48-50	3	5
β-strand	54-56	3	5
β-strand	75-77	3	5
β-strand	85-86	2	6
β-strand	99-101	3	5
β-strand	109-110	2	6
β-strand	123-125	3	5
β-strand	147-149	3	5
α-helix	160-163	4
β-strand	171-173	3	5
α-helix	186-189	4
β-strand	195-197	3	5
β-strand	204	1	7
α-helix	207-209	3
α-helix	210-218	9
α-helix	220-222	3
α-helix	223-228	6
β-strand	230	1	8
β-strand	232	1	7
β-strand	241	1	8
α-helix	247-250	4
α-helix	255-257	3
α-helix	259-292	34

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium-activated potassium channel subunit alpha-1	A, B, C, D	protein	1065	Homo sapiens	Q12791 (AlphaFold model)
Leucine-rich repeat-containing protein 26	E, F, G, H	protein	344	Homo sapiens	Q2I0M4 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8VAV_1 Calcium-activated potassium channel subunit alpha-1 (chains A, B, C, D)
MDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKT
KEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVF
ALSIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLE
VNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLS
IFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLG
RLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFL
KDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESAD
ACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEG
DDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEY
LSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLGFFIAS
DAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNTSP
KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVV
VCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILP
GTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQ
ANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPD
TELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALR
GGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA
HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDSNSLEVLFQ

Sequence of entity 2 (E, F, G, H), FASTA

>8VAV_2 Leucine-rich repeat-containing protein 26 (chains E, F, G, H)
MRGPSWSRPRPLLLLLLLLSPWPVWAQVSATASPSGSLGAPDCPEVCTCVPGGLASCSAL
SLPAVPPGLSLRLRALLLDHNRVRALPPGAFAGAGALQRLDLRENGLHSVHVRAFWGLGA
LQLLDLSANQLEALAPGTFAPLRALRNLSLAGNRLARLEPAALGALPLLRSLSLQDNELA
ALAPGLLGRLPALDALHLRGNPWGCGCALRPLCAWLRRHPLPASEAETVLCVWPGRLTLS
PLTAFSDAAFSHCAQPLALRDLAVVYTLGPASFLVSLASCLALGSGLTACRARRRRLRTA
ALRPPRPPDPNPDPDPHGCASPADPGSPAAAAQAAAAGLEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	20
AJP	Digitonin	C56 H92 O29	32
CLR	Cholesterol	C27 H46 O	4
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Water and common crystallization additives (K) are not listed.

Primary citation

Human Slo1 - human LRRC26 in presence of EDTA - GR masked. Pal, K., Kallure, G., Chowdhury, S. To be published.

Other PDB entries of the same protein (UniProt Q12791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6V5A 2.0 Å, Crystal structure of the human BK channel gating ring L390P mutant
8V60 2.43 Å, F315A mutant of human Slo1 in presence of EDTA - resting VSD
11DA 2.57 Å, Human Slo1-PenitremA complex under divalent chelated condition - full model
9CZM 2.57 Å, Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in nanodisc.
11DC 2.58 Å, Human Slo1-PenitremA complex under divalent chelated condition - gating-ring masked out
11CZ 2.6 Å, Human Slo1-paxilline complex under divalent chelated condition - full model
8V64 2.6 Å, RCK1-RCK2 double mutant of human Slo1 in presence of EDTA - resting VSD
8GHF 2.7 Å, cryo-EM structure of hSlo1 in plasma membrane vesicles
11DB 2.71 Å, Human Slo1-Paxilline complex under divalent chelated condition - gating-ring masked
8V63 2.72 Å, R207A mutant of human Slo1 in presence of EDTA - activated VSD
9JO3 2.8 Å, Cryo-EM structure of human BKca channel-compound 10b complex
8VAZ 2.82 Å, Structure of human Slo1 and human LRRC26 in EDTA - LRRD masked

Browse structure collections

About this viewer

MolViewer shows 8VAV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.