8VHV: PDB entry 8VHV

Transmembrane AMPA Receptor Regulatory Protein Subunit Gamma 2. Determined by electron microscopy at 2.3 Å resolution. Released 22 Jan 2025.

Method: Electron microscopy
Resolution: 2.3 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,335
Mol. weight: 23.2 kDa
Released: 22 Jan 2025

Explore 8VHV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8VHV contains 6 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	7-27	21
β-strand	33-37	5	1
β-strand	56-60	5	1
β-strand	64-67	4	1
β-strand	75-78	4	1
α-helix	94-103	10
α-helix	105-121	17
α-helix	132-158	27
β-strand	174-175	2	1
α-helix	177-205	29
α-helix	206-208	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Voltage-dependent calcium channel gamma-2 subunit	A	protein	210	Mus musculus	O88602 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8VHV_1 Voltage-dependent calcium channel gamma-2 subunit (chains A)
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH
SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL
CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF
YFGALSFIIAEMVGVLAVHMFIDRHKQLTG

Primary citation

Structure of transmembrane AMPA receptor regulatory protein subunit gamma 2. Hale, W.D., Romero, A.M., Koylass, N. et al. Nat Commun (2025) 16:671-671. DOI 10.1038/s41467-025-56027-1 · PubMed

Other PDB entries of the same protein (UniProt O88602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3JXT 1.5 Å, Crystal structure of the third PDZ domain of SAP-102 in complex with a fluorogenic…
8FQF 2.29 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
8FPG 2.32 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
8FQ5 2.34 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma2, with…
8FQB 2.36 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma2, with…
8FPS 2.38 Å, GluA2 flip Q isoform N619K mutant of AMPA receptor in complex with gain-of-function TARP…
8FP4 2.4 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
4X3H 2.4 Å, Crystal structure of arc N-lobe complexed with stargazin peptide
8FP9 2.44 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
9B60 2.57 Å, GluA2 flip Q in complex with TARPgamma2 at pH8, consensus structure of TMD-TARPgamma2
9B5Z 2.71 Å, GluA2 flip Q in complex with TARPgamma2 at pH8, consensus structure of LBD-TMD-TARPgamma2
9B63 2.76 Å, GluA2 flip Q in complex with TARPgamma2 at pH5, consensus structure of TMD-TARPgamma2

Browse structure collections

About this viewer

MolViewer shows 8VHV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.