9B60: GluA2 flip Q

GluA2 flip Q in complex with TARPgamma2 at pH8, consensus structure of TMD-TARPgamma2. Determined by electron microscopy at 2.57 Å resolution. Released 31 Jul 2024.

Method: Electron microscopy
Resolution: 2.57 Å
Organisms: Mus musculus, Rattus norvegicus
Chains: 8
Atoms: 10,461
Mol. weight: 542.22 kDa
Released: 31 Jul 2024

Explore 9B60 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9B60 contains 56 α-helices and 28 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	516-518	3
β-strand	521	1	5
α-helix	523-545	23
α-helix	548-550	3
α-helix	573-584	12
α-helix	596-628	33
β-strand	787	1	6
α-helix	788	1
α-helix	789-791	3
α-helix	793-824	32

Chains B and D: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	509-513	5
α-helix	516-518	3
β-strand	521	1	4
α-helix	523-545	23
α-helix	548-550	3
α-helix	573-584	12
α-helix	596-625	30
α-helix	785-786	2
β-strand	787	1	5
α-helix	788	1
α-helix	789-791	3
α-helix	793-824	32

Chain C: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	516-518	3
β-strand	521	1	3
α-helix	523-545	23
α-helix	548-550	3
α-helix	573-585	13
α-helix	596-628	33
β-strand	787	1	4
α-helix	788	1
α-helix	789-792	4
α-helix	793-824	32

Chain E: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	7-29	23
β-strand	34-38	5	7
β-strand	57-61	5	7
β-strand	65-68	4	7
β-strand	77-79	3	7
α-helix	93-104	12
α-helix	106-126	21
α-helix	133-160	28
β-strand	175	1	7
α-helix	178-213	36

Chain F: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	6-29	24
β-strand	34-37	4	2
β-strand	58-61	4	2
β-strand	65-68	4	2
β-strand	77-79	3	2
α-helix	93-104	12
α-helix	106-125	20
α-helix	133-161	29
β-strand	175	1	2
α-helix	178-213	36

Chain G: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	7-28	22
β-strand	34-38	5	8
β-strand	57-61	5	8
β-strand	65-68	4	8
β-strand	77-79	3	8
α-helix	93-104	12
α-helix	106-125	20
α-helix	133-160	28
β-strand	174-176	3	8
α-helix	178-213	36

Chain H: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	6-29	24
β-strand	34-38	5	1
β-strand	57-61	5	1
β-strand	65-68	4	1
β-strand	77-79	3	1
α-helix	93-104	12
α-helix	106-125	20
α-helix	133-161	29
β-strand	174-176	3	1
α-helix	178-213	36

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Voltage-dependent calcium channel gamma-2 subunit	E, F, G, H	protein	323	Mus musculus	O88602 (AlphaFold model)
Isoform Flip of Glutamate receptor 2	A, B, C, D	protein	889	Rattus norvegicus	P19491 (AlphaFold model)

Sequence of entity 1 (E, F, G, H), FASTA

>9B60_1 Voltage-dependent calcium channel gamma-2 subunit (chains E, F, G, H)
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH
SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL
CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF
YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS
SRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH
NCIQKDSKDSLHANTANRRTTPV

Sequence of entity 2 (A, B, C, D), FASTA

>9B60_2 Isoform Flip of Glutamate receptor 2 (chains A, B, C, D)
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYDIATPKGSSLGTPVNLAVLKLSEQGVL
DKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNPQNINPSSSQNSQNFATDYKDDDDKEGYNVYGIESVKI

Primary citation

Proton-triggered rearrangement of the AMPA receptor N-terminal domains impacts receptor kinetics and synaptic localization. Ivica, J., Kejzar, N., Ho, H. et al. Nat Struct Mol Biol (2024) 31:1601-1613. DOI 10.1038/s41594-024-01369-5 · PubMed

Other PDB entries of the same protein (UniProt O88602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3JXT 1.5 Å, Crystal structure of the third PDZ domain of SAP-102 in complex with a fluorogenic…
8FQF 2.29 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
8VHV 2.3 Å, Transmembrane AMPA Receptor Regulatory Protein Subunit Gamma 2
8FPG 2.32 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
8FQ5 2.34 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma2, with…
8FQB 2.36 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma2, with…
8FPS 2.38 Å, GluA2 flip Q isoform N619K mutant of AMPA receptor in complex with gain-of-function TARP…
8FP4 2.4 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
4X3H 2.4 Å, Crystal structure of arc N-lobe complexed with stargazin peptide
8FP9 2.44 Å, GluA2 flip Q isoform of AMPA receptor in complex with gain-of-function TARP gamma-2,…
9B5Z 2.71 Å, GluA2 flip Q in complex with TARPgamma2 at pH8, consensus structure of LBD-TMD-TARPgamma2
9B63 2.76 Å, GluA2 flip Q in complex with TARPgamma2 at pH5, consensus structure of TMD-TARPgamma2

Browse structure collections

About this viewer

MolViewer shows 9B60 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.