Crystal structure of a transition-state mimic of the GSK-3/Axin complex bound to a beta-catenin S45D peptide. Determined by X-ray diffraction at 2.5 Å resolution. Released 28 Aug 2024.
Explore 8VMF in 3D Show helices and sheets RCSB PDB PDBe
8VMF contains 23 α-helices and 17 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-30 | 3 | 1 |
| β-strand | 36-44 | 9 | 1 |
| β-strand | 52-65 | 14 | 1 |
| β-strand | 68-75 | 8 | 1 |
| β-strand | 81-87 | 7 | 1 |
| β-strand | 93 | 1 | 2 |
| α-helix | 97-102 | 6 | |
| β-strand | 109 | 1 | 3 |
| β-strand | 112-119 | 8 | 1 |
| β-strand | 126-133 | 8 | 1 |
| β-strand | 137-138 | 2 | 3 |
| α-helix | 139-148 | 10 | |
| α-helix | 155-174 | 20 | |
| β-strand | 177-178 | 2 | 4 |
| α-helix | 184-186 | 3 | |
| β-strand | 187-190 | 4 | 3 |
| β-strand | 195-198 | 4 | 3 |
| β-strand | 205-206 | 2 | 4 |
| α-helix | 225-228 | 4 | |
| α-helix | 237-252 | 16 | |
| α-helix | 262-273 | 12 | |
| α-helix | 276-277 | 2 | |
| α-helix | 278-284 | 7 | |
| α-helix | 286-288 | 3 | |
| α-helix | 297-300 | 4 | |
| α-helix | 301-304 | 4 | |
| α-helix | 311-320 | 10 | |
| α-helix | 325-327 | 3 | |
| α-helix | 329-330 | 2 | |
| α-helix | 331-335 | 5 | |
| α-helix | 338-340 | 3 | |
| β-strand | 349 | 1 | 5 |
| α-helix | 354 | 1 | |
| β-strand | 355 | 1 | 5 |
| α-helix | 356 | 1 | |
| α-helix | 371-373 | 3 | |
| α-helix | 374-377 | 4 | |
| α-helix | 380-382 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 385-399 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 46 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glycogen synthase kinase-3 beta | A | protein | 364 | Mus musculus | Q9WV60 (AlphaFold model) |
| Axin-1 | B | protein | 24 | Homo sapiens | O15169 (AlphaFold model) |
| Catenin beta-1 | C | protein | 28 | Homo sapiens | P35222 (AlphaFold model) |
>8VMF_1 Glycogen synthase kinase-3 beta (chains A) MKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIK KVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARH YSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAK QLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQ LVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTP TARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARHH HHHH
>8VMF_2 Axin-1 (chains B) GGILVEPQKFAEELIHRLEAVQRT
>8VMF_3 Catenin beta-1 (chains C) MIHSGATTTAPDLSGKGNPEEEDVDTSQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 2 |
| AF3 | Aluminum fluoride | Al F3 | 1 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
Water and common crystallization additives (GOL, CL) are not listed.
Structural and functional effects of phosphopriming and scaffolding in the kinase GSK-3 beta. Enos, M.D., Gavagan, M., Jameson, N. et al. Sci Signal (2024) 17. DOI 10.1126/scisignal.ado0881 · PubMed
Other PDB entries of the same protein (UniProt Q9WV60 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8VMF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.