8VRP: HIV-CA Disulfide linked Hexamer

HIV-CA Disulfide linked Hexamer bound to 4-Quinazolinone Scaffold inhibitor. Determined by X-ray diffraction at 1.8 Å resolution. Released 23 Jul 2025.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Human immunodeficiency virus 1
Chains: 3
Atoms: 5,649
Mol. weight: 79.19 kDa
Ligands: A1ADQ
Released: 23 Jul 2025

Explore 8VRP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8VRP contains 48 α-helices and 6 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	3
β-strand	10-12	3	3
α-helix	14-16	3
α-helix	17-30	14
α-helix	36-43	8
α-helix	49-57	9
α-helix	63-83	21
α-helix	85-88	4
α-helix	90-92	3
α-helix	97-100	4
α-helix	101-104	4
α-helix	111-118	8
α-helix	126-144	19
α-helix	150-152	3
α-helix	161-174	14
α-helix	179-189	11
α-helix	196-205	10
α-helix	211-219	9

Chain B: 16 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	10-12	3	1
α-helix	14-16	3
α-helix	17-30	14
α-helix	36-43	8
α-helix	49-57	9
α-helix	63-83	21
α-helix	85-88	4
α-helix	90-92	3
α-helix	97-99	3
α-helix	101-104	4
α-helix	111-119	9
α-helix	126-145	20
α-helix	150-152	3
α-helix	161-173	13
α-helix	179-192	14
α-helix	196-205	10
α-helix	211-217	7

Chain C: 16 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	2
β-strand	10-12	3	2
α-helix	14-16	3
α-helix	17-30	14
α-helix	36-43	8
α-helix	49-57	9
α-helix	63-83	21
α-helix	85-88	4
α-helix	90-92	3
α-helix	97-100	4
α-helix	101-104	4
α-helix	111-119	9
α-helix	126-144	19
α-helix	150-152	3
α-helix	161-174	14
α-helix	179-189	11
α-helix	196-205	10
α-helix	211-217	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spacer peptide 1	A, B, C	protein	229	Human immunodeficiency virus 1	P12493

Sequence of entity 1 (A, B, C), FASTA

>8VRP_1 Spacer peptide 1 (chains A, B, C)
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVG
GHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTH
NPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQE
VKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR

Ligands and cofactors

ID	Name	Formula	Copies
A1ADQ	N-[(1S)-1-[(3P,7M)-3-{4-chloro-3-[(ethanesulfonyl)amino]-1-(2,2,2-trifluoroethy…	C43 H32 Cl F9 N8 O5 S	3

Water and common crystallization additives (IOD) are not listed.

Primary citation

Discovery of 4-Quinazolinone-Containing Phenylalanine Derivatives as Potent, Resistant-Tolerant HIV Capsid Inhibitors. Zhang, X., Sun, L., Walsham, L. et al. MedComm (2020) (2026) 7:e70746-e70746. DOI 10.1002/mco2.70746 · PubMed

Other PDB entries of the same protein (UniProt P12493), best resolution first:

8QUK 1.38 Å, Hexameric HIV-1 CA in complex with DDD00100439
8QUH 1.55 Å, Hexameric HIV-1 CA in complex with DDD00057456
8FIU 1.56 Å, Potent long-acting inhibitors targeting HIV-1 capsid based on a versatile…
8QUB 1.63 Å, Hexameric HIV-1 CA in complex with DDD00074110
8QUJ 1.63 Å, Hexameric HIV-1 CA in complex with DDD00100452
8QUL 1.67 Å, Hexameric HIV-1 CA in complex with DDD00100555
8QUI 1.69 Å, Hexameric HIV-1 CA in complex with DDD00024969
5JPA 1.7 Å, Hexameric HIV-1 CA H12Y mutant
8QV9 1.76 Å, Hexameric HIV-1 CA in complex with DDD01829021
4U0C 1.77 Å, Hexameric HIV-1 CA in complex with Nup153 peptide, P6 crystal form
8QUY 1.88 Å, Hexameric HIV-1 CA in complex with DDD01728501
5TSX 1.9 Å, HIV-1 CA hexamer with NUP153 peptide - P1 crystal form

Browse structure collections

About this viewer

MolViewer shows 8VRP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.