8W0G: Human MCM2-7 dimer

Name: PDB 8W0G: Cryo-EM structure of a human MCM2-7 dimer
Published: 2024-10-02
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: replication

Cryo-EM structure of a human MCM2-7 dimer. Determined by electron microscopy at 3.8 Å resolution. Released 2 Oct 2024.

Method: Electron microscopy
Resolution: 3.8 Å
Organism: Homo sapiens
Chains: 12
Atoms: 56,920
Mol. weight: 1099.99 kDa
Ligands: ATP, MG, ZN, ADP
Released: 2 Oct 2024

Explore 8W0G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8W0G contains 322 α-helices and 321 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 2: 27 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	182-187	6
α-helix	189-205	17
α-helix	214-225	12
β-strand	229-233	5	1
α-helix	234-236	3
α-helix	237-241	5
α-helix	243-250	8
α-helix	252-270	19
β-strand	282-286	5	1
β-strand	291-292	2	2
α-helix	299-301	3
β-strand	304-319	16	2
β-strand	322-328	7	3
β-strand	335	1	3
β-strand	339-341	3	3
β-strand	362-369	8	3
β-strand	373-379	7	2
α-helix	380-381	2
α-helix	390-392	3
β-strand	393-398	6	2
α-helix	400-402	3
β-strand	411-422	12	2
α-helix	432-434	3
β-strand	435-446	12	2
α-helix	458-469	12
α-helix	473-480	8
α-helix	489-500	12
β-strand	519-523	5	4
α-helix	529-539	11
β-strand	543-547	5	5
β-strand	558-562	5	2
β-strand	569-573	5	2
α-helix	575-579	5
β-strand	583-587	5	5
α-helix	594-606	13
β-strand	608-613	6	6
β-strand	616-621	6	6
β-strand	625-626	2	5
β-strand	629	1	4
β-strand	632	1	7
β-strand	647	1	7
α-helix	651-655	5
β-strand	659-663	5	4
α-helix	669-685	17
α-helix	688-690	3
α-helix	717-730	14
α-helix	740-753	14
α-helix	764-780	17
α-helix	788-804	17
α-helix	808-817	10
α-helix	819-824	6

Chain 3: 28 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	8
α-helix	10-23	14
α-helix	31-42	12
β-strand	46-50	5	9
α-helix	51-57	7
α-helix	59-67	9
α-helix	70-87	18
α-helix	89-94	6
β-strand	99-103	5	9
β-strand	110-111	2	10
α-helix	118-120	3
β-strand	124-134	11	10
α-helix	135-137	3
β-strand	138-148	11	10
β-strand	153-158	6	10
β-strand	177	1	11
β-strand	183	1	11
β-strand	185-186	2	10
β-strand	192-202	11	10
α-helix	213-214	2
β-strand	217-222	6	10
α-helix	223-225	3
β-strand	234-243	10	10
β-strand	256	1	12
β-strand	258-266	9	10
α-helix	278-290	13
α-helix	295-303	9
α-helix	311-322	12
β-strand	327-328	2	13
β-strand	334-335	2	13
β-strand	341-345	5	14
α-helix	351-361	11
β-strand	365-369	5	14
β-strand	381-384	4	10
β-strand	391-394	4	10
α-helix	397-400	4
β-strand	405-409	5	14
α-helix	411-413	3
α-helix	416-428	13
β-strand	430-433	4	15
α-helix	435-437	3
β-strand	440-443	4	15
β-strand	447-452	6	14
α-helix	453-454	2
α-helix	465-469	5
α-helix	475-478	4
β-strand	481-485	5	14
α-helix	491-506	16
α-helix	562-564	3
α-helix	565-577	13
β-strand	581	1	16
α-helix	584-600	17
α-helix	611-613	3
α-helix	615-631	17
β-strand	636	1	16
α-helix	639-653	15

Chain 4: 23 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	159-171	13
α-helix	192-203	12
β-strand	207-211	5	17
α-helix	212-218	7
α-helix	220-228	9
α-helix	230-245	16
β-strand	259-263	5	17
β-strand	267	1	18
α-helix	276-278	3
β-strand	282-291	10	18
α-helix	294-295	2
β-strand	296-306	11	18
β-strand	312-316	5	18
β-strand	337-356	20	18
α-helix	357	1
α-helix	358-360	3
β-strand	369-375	7	18
β-strand	387-397	11	18
β-strand	400	1	19
β-strand	408-409	2	19
β-strand	411	1	20
β-strand	413-423	11	18
α-helix	443-453	11
α-helix	458-465	8
α-helix	475-485	11
α-helix	487-489	3
β-strand	506-510	5	21
α-helix	516-526	11
β-strand	531-534	4	21
β-strand	546-549	4	22
β-strand	556-559	4	22
α-helix	562-565	4
β-strand	570-574	5	21
α-helix	581-593	13
β-strand	595-598	4	23
β-strand	605-608	4	23
β-strand	612-617	6	21
α-helix	630-634	5
α-helix	638-643	6
β-strand	646-650	5	21
α-helix	656-670	15
α-helix	684-696	13
β-strand	702	1	24
α-helix	704-722	19
α-helix	731-748	18
β-strand	753	1	24
α-helix	755-772	18

Chain 5: 30 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	10	1	25
α-helix	28-41	14
β-strand	44-46	3	26
β-strand	50-52	3	26
α-helix	54-64	11
β-strand	69-70	2	27
β-strand	73	1	28
α-helix	74-80	7
α-helix	82-90	9
α-helix	92-110	19
α-helix	114-115	2
β-strand	125-126	2	27
β-strand	129	1	28
α-helix	133-134	2
α-helix	142-144	3
β-strand	145	1	29
β-strand	148-159	12	29
α-helix	160-161	2
β-strand	162-165	4	12
β-strand	167-172	6	30
β-strand	178-183	6	30
α-helix	184-185	2
β-strand	212-214	3	30
β-strand	221-224	4	12
β-strand	225-230	6	29
α-helix	237	1
α-helix	241-243	3
β-strand	244-249	6	29
β-strand	262-270	9	29
β-strand	293-301	9	29
α-helix	316-327	12
α-helix	331-339	9
α-helix	349-358	10
α-helix	363	1
β-strand	364	1	31
α-helix	365	1
β-strand	370	1	31
β-strand	377-380	4	32
α-helix	387-397	11
β-strand	401-405	5	32
β-strand	417-421	5	29
β-strand	426-430	5	29
α-helix	433-436	4
β-strand	441-445	5	32
α-helix	447-449	3
α-helix	452-464	13
β-strand	466-471	6	33
β-strand	474-479	6	33
β-strand	483-488	6	32
α-helix	508-513	6
β-strand	516-519	4	32
α-helix	556-569	14
β-strand	573-574	2	34
α-helix	576-592	17
α-helix	610-626	17
β-strand	631-632	2	34
α-helix	634-658	25
α-helix	666-682	17
α-helix	691-700	10
α-helix	705-717	13

Chain 6: 27 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	21-36	16
α-helix	45-53	9
β-strand	60-64	5	35
α-helix	65-71	7
α-helix	73-81	9
α-helix	83-101	19
β-strand	111-115	5	35
β-strand	120-121	2	36
α-helix	123-125	3
α-helix	128-130	3
β-strand	131	1	36
β-strand	134-153	20	36
β-strand	154-158	5	37
β-strand	164-168	5	37
β-strand	191-193	3	37
β-strand	199-209	11	36
α-helix	216	1
α-helix	219-221	3
β-strand	224-229	6	36
α-helix	230-233	4
β-strand	241-252	12	36
β-strand	294-305	12	36
α-helix	322-328	7
α-helix	331-342	12
α-helix	346-354	9
α-helix	362-373	12
β-strand	378-379	2	38
β-strand	385-386	2	38
β-strand	391-396	6	39
α-helix	402-412	11
β-strand	416-420	5	39
β-strand	432-435	4	36
β-strand	442-445	4	36
α-helix	448-451	4
β-strand	456-460	5	39
α-helix	462-464	3
α-helix	467-479	13
β-strand	481-486	6	40
β-strand	489-494	6	40
β-strand	498-503	6	39
α-helix	516-519	4
α-helix	524-529	6
β-strand	532-536	5	39
α-helix	542-557	16
α-helix	569-580	12
β-strand	585	1	41
α-helix	588-604	17
β-strand	612	1	42
α-helix	618-634	17
β-strand	639	1	41
α-helix	642-655	14
α-helix	657	1
β-strand	658	1	42
α-helix	659	1

Chain 7: 29 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	6-18	13
β-strand	22-23	2	43
α-helix	25-27	3
β-strand	29-30	2	43
α-helix	32-41	10
β-strand	47-51	5	44
α-helix	52-56	5
α-helix	60-68	9
α-helix	71-88	18
α-helix	97-111	15
α-helix	128-130	3
β-strand	135-139	5	44
β-strand	147	1	20
α-helix	154-156	3
β-strand	160-170	11	20
β-strand	171	1	45
α-helix	172-173	2
β-strand	174-183	10	20
β-strand	190-194	5	20
β-strand	199-200	2	19
α-helix	201-203	3
β-strand	205	1	46
α-helix	209-214	6
β-strand	219	1	46
β-strand	221-222	2	20
β-strand	228-238	11	20
β-strand	252-258	7	20
α-helix	259-261	3
β-strand	270-280	11	20
β-strand	293	1	10
β-strand	295-305	11	20
α-helix	321-328	8
α-helix	332-338	7
α-helix	348-359	12
β-strand	377-381	5	47
α-helix	387-397	11
β-strand	401-404	4	47
β-strand	417-419	3	45
β-strand	428-430	3	45
α-helix	433-436	4
β-strand	440-444	5	47
α-helix	447-449	3
α-helix	452-464	13
β-strand	466-469	4	48
β-strand	476-479	4	48
β-strand	482-488	7	47
α-helix	500	1
α-helix	509-514	6
β-strand	517-521	5	47
α-helix	527-543	17
α-helix	546-548	3
α-helix	552-555	4
α-helix	556-568	13
β-strand	572	1	49
α-helix	575-594	20
α-helix	603-620	18
β-strand	624	1	49
α-helix	627-643	17

Chain A: 27 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	182-187	6
α-helix	189-205	17
α-helix	214-225	12
β-strand	229-233	5	50
α-helix	234-236	3
α-helix	237-241	5
α-helix	243-250	8
α-helix	252-270	19
β-strand	282-286	5	50
β-strand	291	1	51
α-helix	299-301	3
β-strand	304-316	13	51
β-strand	319	1	52
β-strand	322-328	7	53
β-strand	335-341	7	53
β-strand	362-369	8	53
β-strand	373	1	52
β-strand	374-379	6	51
α-helix	380-381	2
α-helix	390-392	3
β-strand	393-398	6	51
β-strand	411-422	12	51
α-helix	432-434	3
β-strand	435-446	12	51
α-helix	458-469	12
α-helix	473-479	7
α-helix	489-500	12
β-strand	519-523	5	54
α-helix	529-539	11
β-strand	543-547	5	55
β-strand	558-562	5	51
β-strand	569-573	5	51
α-helix	575-579	5
β-strand	583-587	5	55
α-helix	594-606	13
β-strand	608-613	6	56
β-strand	616-621	6	56
β-strand	626	1	55
β-strand	629	1	54
α-helix	651-655	5
β-strand	659-663	5	54
α-helix	669-685	17
α-helix	688-690	3
α-helix	712-716	5
α-helix	717-730	14
α-helix	740-753	14
α-helix	764-780	17
α-helix	788-804	17
α-helix	808-817	10
α-helix	819-824	6

Chain B: 27 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	10
α-helix	10-23	14
α-helix	31-42	12
β-strand	46-48	3	57
α-helix	51-57	7
α-helix	59-67	9
α-helix	69-87	19
α-helix	89-94	6
β-strand	99-101	3	57
β-strand	110-111	2	8
α-helix	118-120	3
β-strand	124-134	11	8
α-helix	135-137	3
β-strand	138-148	11	8
β-strand	153-158	6	8
β-strand	177	1	58
β-strand	183	1	58
β-strand	185-186	2	8
β-strand	192-202	11	8
β-strand	217-222	6	8
α-helix	223-225	3
β-strand	234-243	10	8
β-strand	256	1	59
β-strand	258-266	9	8
α-helix	278-290	13
α-helix	294-303	10
α-helix	311-322	12
β-strand	327	1	60
β-strand	335	1	60
β-strand	341-345	5	61
α-helix	351-361	11
β-strand	365-368	4	61
β-strand	381-384	4	8
β-strand	391-394	4	8
α-helix	397-400	4
β-strand	405-408	4	61
α-helix	411-413	3
α-helix	416-428	13
β-strand	430-433	4	62
α-helix	435-437	3
β-strand	440-443	4	62
β-strand	447-452	6	61
α-helix	453-454	2
α-helix	465-469	5
α-helix	474-478	5
β-strand	481-485	5	61
α-helix	491-506	16
α-helix	562-564	3
α-helix	565-577	13
β-strand	581	1	63
α-helix	584-600	17
α-helix	611-613	3
α-helix	615-631	17
β-strand	636	1	63
α-helix	639-653	15

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA replication licensing factor MCM2	2, A	protein	904	Homo sapiens	P49736 (AlphaFold model)
DNA replication licensing factor MCM3	3, B	protein	810	Homo sapiens	P25205 (AlphaFold model)
DNA replication licensing factor MCM4	4, C	protein	866	Homo sapiens	P33991 (AlphaFold model)
DNA replication licensing factor MCM5	5, D	protein	734	Homo sapiens	P33992 (AlphaFold model)
DNA replication licensing factor MCM6	6, E	protein	821	Homo sapiens	Q14566
DNA replication licensing factor MCM7	7, F	protein	719	Homo sapiens	P33993

Sequence of entity 1 (2, A), FASTA

>8W0G_1 DNA replication licensing factor MCM2 (chains 2, A)
MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTE
GPLEEEEDGEELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQR
DREAGRGLGRMRRGLLYDSDEEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGH
SVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAR
EHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQL
HLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPGSCPECQSAGP
FEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN
NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFAS
IAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVS
SRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI
HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDIL
CVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVL
KKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARI
HLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV
AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMI
LQQF

Sequence of entity 2 (3, B), FASTA

>8W0G_2 DNA replication licensing factor MCM3 (chains 3, B)
SNAAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKN
EKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTS
CFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKD
EENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVV
GTYRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQ
LAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYV
LCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMD
RTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSR
FDLLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQED
QQDTQIYEKHDNLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLR
SQDSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVL
EKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMP
QVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEE
PFSSVEIQAALSKMQDDNQVMVSEGIIFLI

Sequence of entity 3 (4, C), FASTA

>8W0G_3 DNA replication licensing factor MCM4 (chains 4, C)
SNAMSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGV
DLQSPAAQDVLFSSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPD
LGSAQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPL
AKEEENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTF
DMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIP
EMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQES
PEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHID
VIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIK
KGILLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKG
SSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLS
IAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEA
YDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDM
RKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPR
TGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITK
DMFEEALRALADDDFLTVTGKTVRLL

Sequence of entity 4 (5, D), FASTA

>8W0G_4 DNA replication licensing factor MCM5 (chains 5, D)
MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELK
RHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEV
LQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLT
NIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGE
MPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQ
VDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGG
SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMR
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNS
RCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLH
VSALTQTQAVEGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDS
DRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGV
EGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGE
IQHRMQRKVLYRLK

Sequence of entity 5 (6, E), FASTA

>8W0G_5 DNA replication licensing factor MCM6 (chains 6, E)
MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNT
LVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNIC
RNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGD
KCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH
LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEY
CRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRL
THYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED

Sequence of entity 6 (7, F), FASTA

>8W0G_6 DNA replication licensing factor MCM7 (chains 7, F)
MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDP
ELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVR
SPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVA
TYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEH
SDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEA
HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVG
GVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR
DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNA
RCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYV
HQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATY
TSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADV
IFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	8
MG	Magnesium ion	Mg	10
ZN	Zinc ion	Zn	10
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

Multiple mechanisms for licensing human replication origins. Yang, R., Hunker, O., Wise, M. et al. Nature (2024) 636:488-498. DOI 10.1038/s41586-024-08237-8 · PubMed

Other PDB entries of the same protein (UniProt P49736 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YA7 1.67 Å, Cdc7-Dbf4 bound to an Mcm2-S40 derived bivalent substrate
7CIZ 1.8 Å, Crystal structure of DNAJC9 HBD helix2 in complex with H3.3-H4 dimer and MCM2 HBD
5BNX 2.31 Å, Crystal structure of Human MCM2 HBD and ASF1b chaperoning a histone H3.3-H4 dimer
5JA4 2.42 Å, Crystal structure of human TONSL and MCM2 HBDs binding to a histone H3-H4 tetramer
7CJ0 2.5 Å, Crystal structure of DNAJC9 HBD in complex with H3.3-H4 dimer and MCM2 HBD
7W1Y 2.59 Å, Human MCM double hexamer bound to natural DNA duplex (polyAT/polyTA)
9E2Z 2.6 Å, Cryo-EM structure of human CMG helicase stalled at G4-containing DNA template
5BNV 2.79 Å, Crystal structure of Human MCM2 HBD chaperoning a histone H3-H4 tetramer
7PLO 2.8 Å, H. sapiens replisome-CUL2/LRR1 complex
8W0F 2.8 Å, Cryo-EM structure of a human MCM2-7 double hexamer on dsDNA
4UUZ 2.9 Å, MCM2-histone complex
5BO0 2.91 Å, Crystal structure of Human MCM2 HBD and ASF1b chaperoning a histone H3.2-H4 dimer

Browse structure collections

About this viewer

MolViewer shows 8W0G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.