8W6B: TAX1BP1 SKICH domain
crystal structure of TAX1BP1 SKICH domain in complex with RB1CC1 coiled-coil domain. Determined by X-ray diffraction at 2.39 Å resolution. Released 10 Jul 2024.
- Method
- X-ray diffraction
- Resolution
- 2.39 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 5,499
- Mol. weight
- 83.38 kDa
- Released
- 10 Jul 2024
Explore 8W6B in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8W6B contains 20 α-helices and 37 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 17-20 | 4 | 1 |
| β-strand | 25-26 | 2 | 2 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 49-54 | 6 | 2 |
| α-helix | 60-62 | 3 | |
| β-strand | 63-68 | 6 | 2 |
| α-helix | 70-72 | 3 | |
| β-strand | 81-87 | 7 | 1 |
| α-helix | 88 | 1 | |
| α-helix | 89-91 | 3 | |
| β-strand | 99-105 | 7 | 2 |
| β-strand | 111-114 | 4 | 2 |
| α-helix | 115-117 | 3 | |
| β-strand | 118-120 | 3 | 2 |
Chain B: 4 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 17-20 | 4 | 3 |
| β-strand | 25-26 | 2 | 4 |
| β-strand | 32-38 | 7 | 3 |
| β-strand | 49-54 | 6 | 5 |
| α-helix | 60-62 | 3 | |
| β-strand | 63-68 | 6 | 5 |
| α-helix | 70-72 | 3 | |
| β-strand | 81-87 | 7 | 3 |
| α-helix | 89-91 | 3 | |
| β-strand | 100-105 | 6 | 5 |
| β-strand | 111-114 | 4 | 5 |
| α-helix | 115-117 | 3 | |
| β-strand | 118 | 1 | 5 |
| β-strand | 119-120 | 2 | 4 |
Chain C: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1341-1393 | 53 | |
Chain D: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1346-1391 | 46 | |
Chain E: 3 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 17-20 | 4 | 6 |
| β-strand | 25-26 | 2 | 7 |
| β-strand | 32-38 | 7 | 6 |
| β-strand | 49-54 | 6 | 7 |
| α-helix | 60-62 | 3 | |
| β-strand | 63-68 | 6 | 7 |
| α-helix | 69-72 | 4 | |
| β-strand | 81-87 | 7 | 6 |
| α-helix | 89-91 | 3 | |
| β-strand | 99-105 | 7 | 7 |
| β-strand | 111-114 | 4 | 7 |
| β-strand | 118-120 | 3 | 7 |
Chain F: 4 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 17-20 | 4 | 8 |
| β-strand | 25-26 | 2 | 9 |
| β-strand | 32-38 | 7 | 8 |
| β-strand | 49-54 | 6 | 9 |
| α-helix | 60-62 | 3 | |
| β-strand | 63-68 | 6 | 9 |
| α-helix | 69-72 | 4 | |
| β-strand | 81-87 | 7 | 8 |
| α-helix | 89-91 | 3 | |
| β-strand | 99-105 | 7 | 9 |
| β-strand | 111-114 | 4 | 9 |
| α-helix | 115-117 | 3 | |
| β-strand | 118-120 | 3 | 9 |
Chain G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1345-1393 | 49 | |
Chain H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1341-1390 | 50 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Tax1-binding protein 1 | A, B, E, F | protein | 121 | Homo sapiens | Q86VP1 (AlphaFold model) |
| RB1-inducible coiled-coil protein 1 | C, D, G, H | protein | 57 | Homo sapiens | Q8TDY2 (AlphaFold model) |
Sequence of entity 1 (A, B, E, F), FASTA
>8W6B_1 Tax1-binding protein 1 (chains A, B, E, F)
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTA
RDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQF
R
Sequence of entity 2 (C, D, G, H), FASTA
>8W6B_2 RB1-inducible coiled-coil protein 1 (chains C, D, G, H)
GSEFKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSS
Primary citation
Mechanistic insights into the interactions of TAX1BP1 with RB1CC1 and mammalian ATG8 family proteins. Zhang, M., Wang, Y., Gong, X. et al. Proc Natl Acad Sci U S A (2024) 121:e2315550121-e2315550121. DOI 10.1073/pnas.2315550121 · PubMed
Other PDB entries of the same protein (UniProt Q86VP1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5YT6 1.5 Å, Crystal structure of TAX1BP1 UBZ2 in complex with mono-ubiquitin
- 8W6A 1.53 Å, Crystal structure of TAX1BP1 LIR region in complex with GABARAP
- 4NLH 1.9 Å, SKICH domain of human TAX1BP1
- 4Z4M 2.15 Å, Crystal structure of GFP-TAX1BP1 UBZ2 domain fusion protein
- 5Z7G 2.3 Å, Crystal structure of TAX1BP1 SKICH region in complex with NAP1
- 4BMJ 2.75 Å, Structure of the UBZ1and2 tandem of the ubiquitin-binding adaptor protein TAX1BP1
- 4Z4K 2.8 Å, Crystal structure of GFP-TAX1BP1 UBZ1+2 domain fusion protein
- 2M7Q Solution structure of TAX1BP1 UBZ1+2
- 5AAS The selective autophagy receptor TAX1BP1 is required for autophagy- dependent capture of…
Browse structure collections
About this viewer
MolViewer shows 8W6B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.