8WF6: 14-3-3 zeta

14-3-3 zeta complexed with S559 phosphorylated peptide derived from GPIb alpha cytoplasmic domain. Determined by X-ray diffraction at 2.47 Å resolution. Released 25 Sept 2024.

Method: X-ray diffraction
Resolution: 2.47 Å
Organism: Homo sapiens
Chains: 8
Atoms: 7,160
Mol. weight: 117.6 kDa
Ligands: SIN
Released: 25 Sept 2024

Explore 8WF6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8WF6 contains 51 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	35-37	3
α-helix	38-67	30
α-helix	74-100	27
α-helix	101-105	5
α-helix	106-108	3
α-helix	112-132	21
α-helix	136-158	23
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-202	18
α-helix	211-228	18

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	34-37	4
α-helix	38-67	30
α-helix	74-100	27
α-helix	101-105	5
α-helix	106-108	3
α-helix	112-131	20
α-helix	136-159	24
α-helix	165-180	16
α-helix	185-204	20
α-helix	211-230	20

Chain C: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	34-36	3
α-helix	38-67	30
α-helix	73-100	28
α-helix	101-105	5
α-helix	106-108	3
α-helix	112-131	20
α-helix	135-159	25
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-202	18
α-helix	209-228	20

Chain D: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	35-37	3
α-helix	38-67	30
α-helix	73-100	28
α-helix	101-105	5
α-helix	106-108	3
α-helix	112-130	19
α-helix	135-159	25
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-202	18
α-helix	211-229	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein zeta/delta	A, B, C, D	protein	246	Homo sapiens	P63104 (AlphaFold model)
S559 phosphorylated peptide	E, F, Q, R	protein	12	Homo sapiens	P07359 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8WF6_1 14-3-3 protein zeta/delta (chains A, B, C, D)
SMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSW
RVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYL
KMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYY
EILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEA
GEGGEN

Sequence of entity 2 (E, F, Q, R), FASTA

>8WF6_2 S559 phosphorylated peptide (chains E, F, Q, R)
LFLRGSLPTFRS

Ligands and cofactors

ID	Name	Formula	Copies
SIN	Succinic acid	C4 H6 O4	2

Primary citation

Cryo-EM structure of GPIb-IX Complex. Shu, Z.M., Zhou, A.W. To be published.

Other PDB entries of the same protein (UniProt P63104 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2O02 1.5 Å, Phosphorylation independent interactions between 14-3-3 and Exoenzyme S: from structure…
6F09 1.59 Å, Binary complex of 14-3-3 zeta with ubiquitin specific protease 8 (USP8) pSer718 peptide
7ZIT 1.79 Å, 14-3-3 in complex with SARS-COV2 N phospho-peptide
9UJ2 1.8 Å, 14-3-3 zeta chimera with the S202R peptide of SARS-CoV-2 N (residues 200-213)
6ZFG 1.85 Å, 14-3-3 zeta chimera with 18E6 and fusicoccin
6F08 1.9 Å, 14-3-3 zeta in complex with the human Son of sevenless homolog 1 (SOS1)
6ZFD 1.9 Å, 14-3-3 zeta bound to the phosphorylated 18E6 C-terminus
4FJ3 1.95 Å, 14-3-3 isoform zeta in complex with a diphoyphorylated C-RAF peptide
5EXA 1.95 Å, Small-molecule stabilization of the 14-3-3/Gab2 PPI interface
8P1H 1.95 Å, Crystal structure of the chimera of human 14-3-3 zeta and phosphorylated cytoplasmic…
8A9G 1.96 Å, Binary complex of 14-3-3 zeta Glucocorticoid Receptor (GR) pT524 peptide stabilised by…
1QJA 2.0 Å, 14-3-3 zeta/phosphopeptide complex (mode 2)

Browse structure collections

About this viewer

MolViewer shows 8WF6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.