8X0F: Metabotropic glutamate receptor 5

Human FL Metabotropic glutamate receptor 5, mGlu5-5M with quisqualate and PAM VU29. Determined by electron microscopy at 3.3 Å resolution. Released 6 Nov 2024.

Method: Electron microscopy
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 12,073
Mol. weight: 188.59 kDa
Ligands: NAG, QUS, XRQ
Released: 6 Nov 2024

Explore 8X0F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8X0F contains 56 α-helices and 62 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	29	1	1
β-strand	35-41	7	1
β-strand	44	1	2
α-helix	46-48	3
α-helix	49-51	3
β-strand	60	1	2
α-helix	62-66	5
α-helix	67-81	15
β-strand	91-97	7	1
α-helix	102-112	11
β-strand	143-148	6	1
α-helix	152-162	11
α-helix	163-165	3
β-strand	169-171	3	1
α-helix	177-180	4
β-strand	188-190	3	1
α-helix	195-208	14
β-strand	213-219	7	3
α-helix	223-236	14
β-strand	241-248	8	3
α-helix	254-265	12
β-strand	273-277	5	3
α-helix	280-292	13
β-strand	300-302	3	3
α-helix	318-321	4
β-strand	325-329	5	3
α-helix	335-341	7
α-helix	355-362	8
α-helix	397-418	22
α-helix	434-442	9
β-strand	446-447	2	4
β-strand	453-454	2	4
β-strand	466-473	8	3
β-strand	479-488	10	3
β-strand	491-494	4	3
β-strand	520	1	5
β-strand	523	1	6
β-strand	533	1	6
β-strand	536	1	5
β-strand	541	1	7
β-strand	545	1	8
β-strand	548	1	8
α-helix	550	1
β-strand	551	1	7
α-helix	552	1
β-strand	558	1	9
β-strand	565	1	9
β-strand	571	1	10
α-helix	578-603	26
α-helix	615-634	20
α-helix	644-669	26
α-helix	692-714	23
β-strand	719-720	2	11
β-strand	725	1	12
β-strand	728	1	12
β-strand	730	1	10
β-strand	732-733	2	11
α-helix	737-761	25
α-helix	771-794	24
α-helix	799-826	28

Chain B: 30 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	31	1	13
β-strand	35-41	7	13
β-strand	44	1	14
α-helix	45-48	4
β-strand	60	1	14
α-helix	62-67	6
α-helix	68-80	13
β-strand	91-97	7	13
α-helix	102-113	12
α-helix	114-116	3
β-strand	143-147	5	13
α-helix	152-162	11
α-helix	163-165	3
β-strand	169-171	3	13
α-helix	177-180	4
β-strand	188-190	3	13
α-helix	196-208	13
β-strand	213-219	7	15
α-helix	223-236	14
β-strand	241-248	8	15
α-helix	254-266	13
β-strand	273-277	5	15
α-helix	280-292	13
β-strand	300-302	3	15
α-helix	318-320	3
β-strand	325-328	4	15
α-helix	332-334	3
α-helix	335-341	7
α-helix	355-362	8
α-helix	397-418	22
α-helix	434-441	8
β-strand	446-447	2	16
β-strand	453-454	2	16
β-strand	467-475	9	15
β-strand	478-483	6	15
β-strand	485-487	3	17
β-strand	492-494	3	17
α-helix	507-508	2
β-strand	520-521	2	18
β-strand	535-536	2	18
α-helix	537-538	2
β-strand	541-543	3	19
β-strand	549-551	3	19
β-strand	557-558	2	20
α-helix	560-562	3
β-strand	565-566	2	20
β-strand	571	1	21
α-helix	578-603	26
α-helix	608-610	3
α-helix	617-635	19
α-helix	641-669	29
α-helix	693-714	22
β-strand	719-722	4	21
β-strand	730-733	4	21
α-helix	737-763	27
α-helix	770-786	17
α-helix	788-794	7
α-helix	799-826	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Metabotropic glutamate receptor 5	A, B	protein	836	Homo sapiens	P41594 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8X0F_1 Metabotropic glutamate receptor 5 (chains A, B)
QSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERIN
SDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSSFRSK
KPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQAR
AMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKL
LKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFLLLGSDGWADRYDVTDGYQRE
AVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQHRFQCRLEGFPQENSKYNKT
CNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCPGYAGLCDAMKPIDGRKLLES
LMKTAFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVW
SKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYVFDEYTCKACQLGSWPTD
DLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYI
ILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKI
CTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGV
VAPLGYNGLLILACTFYAFKTRNVPANFNEAKYIAFAMYTTCIIWLAFVPIYFGSNYKAI
TMCFSVSLSATVLLGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGKSSSAA

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2
QUS	(s)-2-amino-3-(3,5-dioxo-[1,2,4]OXADIAZOLIDIN-2-yl)-propionic acid	C5 H7 N3 O5	2
XRQ	N-(1,3-diphenyl-1H-pyrazol-5-yl)-4-nitrobenzamide	C22 H16 N4 O3	1

Primary citation

Conformational diversity in class C GPCR positive allosteric modulation. Cannone, G., Berto, L., Malhaire, F. et al. Nat Commun (2025) 16:619-619. DOI 10.1038/s41467-024-55439-9 · PubMed

Other PDB entries of the same protein (UniProt P41594 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6FFI 2.2 Å, Crystal Structure of mGluR5 in complex with MMPEP at 2.2 A
9HC0 2.33 Å, Dark structure of the human metabotropic glutamate receptor 5 transmembrane domain bound…
3LMK 2.44 Å, Ligand Binding Domain of Metabotropoc glutamate receptor mGluR5 complexed with glutamate
7P2L 2.54 Å, thermostabilised 7TM domain of human mGlu5 receptor bound to photoswitchable ligand…
4OO9 2.6 Å, Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane…
5CGD 2.6 Å, Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane…
6FFH 2.65 Å, Crystal Structure of mGluR5 in complex with Fenobam at 2.65 A
8TAO 2.9 Å, Quis and CDPPB bound active mGlu5
9HC3 2.9 Å, Apo-state structure of the human metabotropic glutamate receptor 5 transmembrane domain…
8T8M 3.0 Å, Quis-bound intermediate mGlu5
8X0G 3.0 Å, Human FL Metabotropic glutamate receptor 5, mGlu5-5M with quisqualate, Acc conformation…
8X0B 3.1 Å, Human FL Metabotropic glutamate receptor 5, mGlu5-5M with Quisqualate and VU0424465

Browse structure collections

About this viewer

MolViewer shows 8X0F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.