8X3H: Iron-bound recombinant ovotransferrin N-lobe

Crystal structure of iron-bound recombinant ovotransferrin N-lobe at 0.93 angstrom resolution. Determined by X-ray diffraction at 0.93 Å resolution. Released 13 Dec 2023.

Method: X-ray diffraction
Resolution: 0.93 Å
Organism: Gallus gallus
Chains: 1
Atoms: 3,494
Mol. weight: 36.74 kDa
Ligands: CO3, FE
Released: 13 Dec 2023

Explore 8X3H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8X3H contains 20 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	5-11	7	1
α-helix	14-27	14
β-strand	32-38	7	1
α-helix	42-50	9
β-strand	56	1	1
β-strand	57-59	3	2
α-helix	61-68	8
β-strand	75-84	10	2
β-strand	87-89	3	2
β-strand	91-99	9	3
α-helix	106-108	3
β-strand	113-116	4	3
α-helix	122-126	5
α-helix	127-134	8
α-helix	143-145	3
α-helix	148-155	8
β-strand	158-160	3	3
α-helix	168-170	3
α-helix	190-199	10
β-strand	205-209	5	3
α-helix	212-216	5
α-helix	221-223	3
β-strand	224-227	4	3
β-strand	233-235	3	3
α-helix	236-241	6
β-strand	245-248	4	3
α-helix	249-250	2
β-strand	251-254	4	2
α-helix	260-274	15
α-helix	293-295	3
β-strand	304-309	6	2
α-helix	310-311	2
α-helix	316-320	5
α-helix	322-330	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ovotransferrin	A	protein	332	Gallus gallus	P02789 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8X3H_1 Ovotransferrin (chains A)
APPKSVIRWCTISSPEEKKCNNLRDLTQQERISLTCVQKATYLDCIKAIANNEADAISLD
GGQVFEAGLAPYKLKPIAAEVYEHTEGSTTSYYAVAVVKKGTEFTVNDLQGKTSCHTGLG
RSAGWNIPIGTLIHRGAIEWEGIESGSVEQAVAKFFSASCVPGATIEQKLCRQCKGDPKT
KCARNAPYSGYSGAFHCLKDGKGDVAFVKHTTVNENAPDQKDEYELLCLDGSRQPVDNYK
TCNWARVAAHAVVARDDNKVEDIWSFLSKAQSDFGVDTKSDFHLFGPPGKKDPVLKDLLF
KDSAIMLKRVPSLMDSQLYLGFEYYSAIQSMR

Ligands and cofactors

ID	Name	Formula	Copies
CO3	Carbonate ion	C O3	1
FE	FE (III) ion	Fe	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Crystal structure of iron-bound ovotransferrin N-lobe at atomic resolution. Toyoda, M., Tanabe, A., Mikami, B. et al. To be published.

Other PDB entries of the same protein (UniProt P02789 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IEJ 1.65 Å, Ovotransferrin, N-terminal lobe, holo form, at 1.65 a resolution
1TFA 1.9 Å, Ovotransferrin, N-terminal lobe, apo form
1NFT 2.1 Å, Ovotransferrin, N-terminal lobe, iron loaded open form
2D3I 2.15 Å, Crystal Structure of Aluminum-Bound Ovotransferrin at 2.15 Angstrom Resolution
1IQ7 2.3 Å, Ovotransferrin, C-Terminal Lobe, Apo Form
1NNT 2.3 Å, Structural evidence for a PH-sensitive di-lysine trigger in the hen ovotransferrin…
1OVT 2.4 Å, Refined crystallographic structure of hen ovotransferrin at 2.4 Å resolution
1N04 2.8 Å, Diferric chicken serum transferrin at 2.8 A resolution.
1AIV 3.0 Å, Apo ovotransferrin
8FEI 3.0 Å, CryoEM structure of Conalbumin from chicken egg white (sigma-Cas 1391-06-6)
1D9K 3.2 Å, Crystal structure of complex between D10 TCR and pmhc I-ak/ca
1RYX 3.5 Å, Crystal structure of hen serum transferrin in apo- form

Browse structure collections

About this viewer

MolViewer shows 8X3H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.