8XFY: RSK2 from Biortus

The Crystal Structure of RSK2 from Biortus. Determined by X-ray diffraction at 3.2 Å resolution. Released 6 Mar 2024.

Method

X-ray diffraction

Resolution

3.2 Å

Organism

Homo sapiens

Chains

10

Atoms

22,210

Mol. weight

373.05 kDa

Ligands

A1LU8

Released

6 Mar 2024

Explore 8XFY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XFY contains 140 α-helices and 120 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 13 β-strands

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

>8XFY_1 Ribosomal protein S6 kinase alpha-3 (chains A, B, C, D, E, F, G, H, I, J)
PQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAM
KVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRL
SKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESI
DHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTM
ILKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRRE
IHPPFKPATGRPEDTFYFDP

Ligands and cofactors

Primary citation

The Crystal Structure of RSK2 from Biortus. Wang, F., Cheng, W., Lv, Z. et al. To be published.

Related structures

Other PDB entries of the same protein (UniProt P51812 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 4NW6 1.74 Å, Rsk2 N-terminal kinase in complex with 2-amino-7-substituted benzoxazole compound 27
• 8EQ5 1.8 Å, Crystal structure of the N-terminal kinase domain of RSK2 in complex with SPRED2 (131-160)
• 4NW5 1.94 Å, Rsk2 N-terminal kinase in complex with 2-amino-7-substituted benzoxazole compound 8
• 5D9L 2.15 Å, Rsk2 N-terminal Kinase in Complex with bis-phenol pyrazole
• 8R58 2.31 Å, The RSK 2 N-terminal kinase domain in complex with BMF (1-19)
• 4NUS 2.39 Å, Rsk2 N-terminal kinase in complex with LJH685
• 4D9T 2.4 Å, Rsk2 C-terminal Kinase Domain with inhibitor (E)-methyl…
• 4D9U 2.4 Å, Rsk2 C-terminal Kinase Domain, (E)-tert-butyl 3-(4-amino-7-(3-hydroxypropyl)-5-p-tolyl-7H…
• 5D9K 2.55 Å, Rsk2 N-terminal Kinase in Complex with BI-D1870
• 4JG6 2.6 Å, RSK2 CTD bound to 2-cyano-3-(1H-indazol-5-yl)acrylamide
• 8XEY 2.65 Å, The Crystal Structure of C-terminal kinase domain of RSK2 from Biortus
• 7OPO 2.75 Å, RSK2 N-terminal kinase domain in complex with ORF45

Browse structure collections

About this viewer

MolViewer shows 8XFY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.