8XKW: TOM40 complex unannealed

Structure of the TOM40 complex unannealed. Determined by electron microscopy at 3.64 Å resolution. Released 25 Dec 2024.

Method: Electron microscopy
Resolution: 3.64 Å
Organism: Saccharomyces cerevisiae
Chains: 10
Atoms: 7,520
Mol. weight: 161.09 kDa
Released: 25 Dec 2024

Explore 8XKW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XKW contains 24 α-helices and 50 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and F: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	50-53	4
α-helix	57-62	6
α-helix	64-67	4
α-helix	68-71	4
β-strand	85-93	9	1
β-strand	97-105	9	1
β-strand	114	1	1
β-strand	115-116	2	2
β-strand	117-121	5	1
β-strand	125-130	6	1
β-strand	131-132	2	2
α-helix	133-135	3
β-strand	137-143	7	1
β-strand	149-157	9	1
β-strand	164-172	9	1
β-strand	176-187	12	1
β-strand	193-206	14	1
β-strand	209-217	9	1
β-strand	228-237	10	1
β-strand	243-250	8	1
β-strand	254-262	9	1
β-strand	267-274	8	1
β-strand	276	1	3
β-strand	298	1	3
β-strand	301-308	8	1
β-strand	312-319	8	1
β-strand	323-330	8	1
β-strand	338-345	8	1
β-strand	350-357	8	1
β-strand	362	1	1
α-helix	365-372	8

Chains B and G: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	87-134	48

Chains C and H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	14-48	35

Chains D and I: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	31-50	20
α-helix	52-57	6

Chains E and J: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	16-43	28
α-helix	50-54	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitochondrial import receptor subunit TOM22	B, G	protein	172	Saccharomyces cerevisiae	P49334 (AlphaFold model)
Mitochondrial import receptor subunit TOM5	C, H	protein	50	Saccharomyces cerevisiae	P80967 (AlphaFold model)
Mitochondrial import receptor subunit TOM6	D, I	protein	61	Saccharomyces cerevisiae	P33448 (AlphaFold model)
Mitochondrial import receptor subunit TOM7	E, J	protein	60	Saccharomyces cerevisiae	P53507 (AlphaFold model)
Mitochondrial import receptor subunit TOM40	A, F	protein	387	Saccharomyces cerevisiae	P23644

Sequence of entity 1 (B, G), FASTA

>8XKW_1 Mitochondrial import receptor subunit TOM22 (chains B, G)
MVELTEIKDDVVQLDEPQFSRNQAIVEEKASATNNDVVDDEDDSDSDFEDEFDENETLLD
RIVALKDIVPPGKRQTISNFFGFTSSFVRNAFTKSGNLAWTLTTTALLLGVPLSLSILAE
QQLIEMEKTFDLQSDANNILAQGEKDAAATANRTLQVDGSPGHHHHHHHHHH

Sequence of entity 2 (C, H), FASTA

>8XKW_2 Mitochondrial import receptor subunit TOM5 (chains C, H)
MFGLPQQEVSEEEKRAHQEQTEKTLKQAAYVAAFLWVSPMIWHLVKKQWK

Sequence of entity 3 (D, I), FASTA

>8XKW_3 Mitochondrial import receptor subunit TOM6 (chains D, I)
MDGMFAMPGAAAGAASPQQPKSRFQAFKESPLYTIALNGAFFVAGVAFIQSPLMDMLAPQ
L

Sequence of entity 4 (E, J), FASTA

>8XKW_4 Mitochondrial import receptor subunit TOM7 (chains E, J)
MSFLPSFILSDESKERISKILTLTHNVAHYGWIPFVLYLGWAHTSNRPNFLNLLSPLPSV

Sequence of entity 5 (A, F), FASTA

>8XKW_5 Mitochondrial import receptor subunit TOM40 (chains A, F)
MSAPTPLAEASQIPTIPALSPLTAKQSKGNFFSSNPISSFVVDTYKQLHSHRQSLELVNP
GTVENLNKEVSRDVFLSQYFFTGLRADLNKAFSMNPAFQTSHTFSIGSQALPKYAFSALF
ANDNLFAQGNIDNDLSVSGRLNYGWDKKNISKVNLQISDGQPTMCQLEQDYQASDFSVNV
KTLNPSFSEKGEFTGVAVASFLQSVTPQLALGLETLYSRTDGSAPGDAGVSYLTRYVSKK
QDWIFSGQLQANGALIASLWRKVAQNVEAGIETTLQAGMVPITDPLMGTPIGIQPTVEGS
TTIGAKYEYRQSVYRGTLDSNGKVACFLERKVLPTLSVLFCGEIDHFKNDTKIGCGLQFE
TAGNQELLMLQQGLDADGNPLQALPQL

Primary citation

Structure of the TOM40 complex unannealed. Yang, L.Y., Shen, Q.T. To be published.

Other PDB entries of the same protein (UniProt P49334 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9J99 2.94 Å, Substrate-engaged TOM complex from yeast
6UCU 3.06 Å, Cryo-EM structure of the mitochondrial TOM complex from yeast (dimer)
8XKY 3.42 Å, Structure of the TOM40 complex annealed
8W5K 3.6 Å, Cryo-EM structure of the yeast TOM core complex crosslinked by BS3 (from TOM-TIM23…
8XKX 3.7 Å, Structure of the TOM40 complex with pre-protein
6JNF 3.81 Å, Cryo-EM structure of the translocator of the outer mitochondrial membrane
6UCV 4.1 Å, Cryo-EM structure of the mitochondrial TOM complex from yeast (tetramer)
8HCO 4.1 Å, Substrate-engaged TOM complex from yeast
8W5J 4.4 Å, Cryo-EM structure of the yeast TOM core complex (from TOM-TIM23 complex)

Browse structure collections

About this viewer

MolViewer shows 8XKW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.