8XKY: TOM40 complex annealed

Structure of the TOM40 complex annealed. Determined by electron microscopy at 3.42 Å resolution. Released 25 Dec 2024.

Method: Electron microscopy
Resolution: 3.42 Å
Organism: Saccharomyces cerevisiae
Chains: 10
Atoms: 7,596
Mol. weight: 161.09 kDa
Released: 25 Dec 2024

Explore 8XKY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XKY contains 26 α-helices and 44 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and F: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	51-55	5
α-helix	57-62	6
α-helix	64-67	4
α-helix	68-71	4
β-strand	84-93	10	1
β-strand	97-106	10	1
β-strand	114-121	8	1
β-strand	125-132	8	1
α-helix	133-135	3
β-strand	136-143	8	1
β-strand	149-158	10	1
β-strand	164-172	9	1
β-strand	176-187	12	1
β-strand	193-206	14	1
β-strand	209-217	9	1
α-helix	225-227	3
β-strand	228-237	10	1
β-strand	243-249	7	1
β-strand	255-262	8	1
β-strand	267-275	9	1
β-strand	301-308	8	1
β-strand	312-319	8	1
β-strand	323-330	8	1
β-strand	337	1	2
β-strand	338-345	8	1
β-strand	350-355	6	1
β-strand	358	1	2
β-strand	359-362	4	1
α-helix	365-372	8

Chains B and G: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	87-134	48

Chains C and H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	14-48	35

Chains D and I: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	31-49	19
α-helix	52-57	6

Chains E and J: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	12-43	32
α-helix	50-54	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitochondrial import receptor subunit TOM22	B, G	protein	172	Saccharomyces cerevisiae	P49334 (AlphaFold model)
Mitochondrial import receptor subunit TOM5	C, H	protein	50	Saccharomyces cerevisiae	P80967 (AlphaFold model)
Mitochondrial import receptor subunit TOM6	D, I	protein	61	Saccharomyces cerevisiae	P33448 (AlphaFold model)
Mitochondrial import receptor subunit TOM7	E, J	protein	60	Saccharomyces cerevisiae	P53507 (AlphaFold model)
Mitochondrial import receptor subunit TOM40	A, F	protein	387	Saccharomyces cerevisiae	P23644

Sequence of entity 1 (B, G), FASTA

>8XKY_1 Mitochondrial import receptor subunit TOM22 (chains B, G)
MVELTEIKDDVVQLDEPQFSRNQAIVEEKASATNNDVVDDEDDSDSDFEDEFDENETLLD
RIVALKDIVPPGKRQTISNFFGFTSSFVRNAFTKSGNLAWTLTTTALLLGVPLSLSILAE
QQLIEMEKTFDLQSDANNILAQGEKDAAATANRTLQVDGSPGHHHHHHHHHH

Sequence of entity 2 (C, H), FASTA

>8XKY_2 Mitochondrial import receptor subunit TOM5 (chains C, H)
MFGLPQQEVSEEEKRAHQEQTEKTLKQAAYVAAFLWVSPMIWHLVKKQWK

Sequence of entity 3 (D, I), FASTA

>8XKY_3 Mitochondrial import receptor subunit TOM6 (chains D, I)
MDGMFAMPGAAAGAASPQQPKSRFQAFKESPLYTIALNGAFFVAGVAFIQSPLMDMLAPQ
L

Sequence of entity 4 (E, J), FASTA

>8XKY_4 Mitochondrial import receptor subunit TOM7 (chains E, J)
MSFLPSFILSDESKERISKILTLTHNVAHYGWIPFVLYLGWAHTSNRPNFLNLLSPLPSV

Sequence of entity 5 (A, F), FASTA

>8XKY_5 Mitochondrial import receptor subunit TOM40 (chains A, F)
MSAPTPLAEASQIPTIPALSPLTAKQSKGNFFSSNPISSFVVDTYKQLHSHRQSLELVNP
GTVENLNKEVSRDVFLSQYFFTGLRADLNKAFSMNPAFQTSHTFSIGSQALPKYAFSALF
ANDNLFAQGNIDNDLSVSGRLNYGWDKKNISKVNLQISDGQPTMCQLEQDYQASDFSVNV
KTLNPSFSEKGEFTGVAVASFLQSVTPQLALGLETLYSRTDGSAPGDAGVSYLTRYVSKK
QDWIFSGQLQANGALIASLWRKVAQNVEAGIETTLQAGMVPITDPLMGTPIGIQPTVEGS
TTIGAKYEYRQSVYRGTLDSNGKVACFLERKVLPTLSVLFCGEIDHFKNDTKIGCGLQFE
TAGNQELLMLQQGLDADGNPLQALPQL

Primary citation

Structure of the TOM40 complex annealed. Yang, L.Y., Shen, Q.T. To be published.

Other PDB entries of the same protein (UniProt P49334 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9J99 2.94 Å, Substrate-engaged TOM complex from yeast
6UCU 3.06 Å, Cryo-EM structure of the mitochondrial TOM complex from yeast (dimer)
8W5K 3.6 Å, Cryo-EM structure of the yeast TOM core complex crosslinked by BS3 (from TOM-TIM23…
8XKW 3.64 Å, Structure of the TOM40 complex unannealed
8XKX 3.7 Å, Structure of the TOM40 complex with pre-protein
6JNF 3.81 Å, Cryo-EM structure of the translocator of the outer mitochondrial membrane
6UCV 4.1 Å, Cryo-EM structure of the mitochondrial TOM complex from yeast (tetramer)
8HCO 4.1 Å, Substrate-engaged TOM complex from yeast
8W5J 4.4 Å, Cryo-EM structure of the yeast TOM core complex (from TOM-TIM23 complex)

Browse structure collections

About this viewer

MolViewer shows 8XKY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.