Crystal structure of TTD-PHD domain of UHRF1 in complex with mStella peptide (residues 85-119). Determined by X-ray diffraction at 3.2 Å resolution. Released 6 Nov 2024.
Explore 8XV4 in 3D Show helices and sheets RCSB PDB PDBe
8XV4 contains 25 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 135-136 | 2 | |
| β-strand | 140-144 | 5 | 1 |
| β-strand | 151-162 | 12 | 1 |
| α-helix | 163-164 | 2 | |
| α-helix | 178-180 | 3 | |
| β-strand | 181-188 | 8 | 1 |
| α-helix | 192-194 | 3 | |
| β-strand | 196-200 | 5 | 1 |
| α-helix | 201-203 | 3 | |
| β-strand | 204-206 | 3 | 1 |
| α-helix | 207-208 | 2 | |
| α-helix | 210 | 1 | |
| β-strand | 211-212 | 2 | 1 |
| α-helix | 213 | 1 | |
| α-helix | 214-216 | 3 | |
| β-strand | 222-227 | 6 | 1 |
| β-strand | 237-248 | 12 | 1 |
| β-strand | 253-259 | 7 | 1 |
| β-strand | 269-271 | 3 | 1 |
| β-strand | 277-278 | 2 | 1 |
| α-helix | 279-282 | 4 | |
| β-strand | 318 | 1 | 2 |
| α-helix | 327-329 | 3 | |
| β-strand | 330-332 | 3 | 2 |
| β-strand | 339-341 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 135-136 | 2 | |
| β-strand | 140-144 | 5 | 3 |
| β-strand | 151-162 | 12 | 3 |
| α-helix | 163-164 | 2 | |
| α-helix | 178-180 | 3 | |
| β-strand | 181-188 | 8 | 3 |
| α-helix | 192-194 | 3 | |
| β-strand | 196-200 | 5 | 3 |
| β-strand | 204-206 | 3 | 3 |
| α-helix | 207-208 | 2 | |
| α-helix | 210 | 1 | |
| β-strand | 211-212 | 2 | 3 |
| α-helix | 213 | 1 | |
| α-helix | 214-216 | 3 | |
| β-strand | 222-227 | 6 | 3 |
| β-strand | 237-248 | 12 | 3 |
| β-strand | 253-259 | 7 | 3 |
| β-strand | 266-271 | 6 | 3 |
| β-strand | 277-278 | 2 | 3 |
| α-helix | 279-282 | 4 | |
| β-strand | 302 | 1 | 4 |
| β-strand | 305 | 1 | 5 |
| β-strand | 306 | 1 | 4 |
| β-strand | 307 | 1 | 5 |
| β-strand | 318 | 1 | 6 |
| α-helix | 327-329 | 3 | |
| β-strand | 330-332 | 3 | 6 |
| β-strand | 339-341 | 3 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 90 | 1 | 2 |
| α-helix | 91-96 | 6 | |
| α-helix | 98-109 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 90 | 1 | 6 |
| α-helix | 91-96 | 6 | |
| α-helix | 98-108 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase UHRF1 | A, B | protein | 229 | Homo sapiens | Q96T88 (AlphaFold model) |
| Developmental pluripotency-associated protein 3 | C, D | protein | 35 | Mus musculus | Q8QZY3 (AlphaFold model) |
>8XV4_1 E3 ubiquitin-protein ligase UHRF1 (chains A, B) GPLGSLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRPALEEDVIYHVKYDDYPENGVV QMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYA NVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCA CHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
>8XV4_2 Developmental pluripotency-associated protein 3 (chains C, D) KRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNE
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 7 |
Defining ortholog-specific UHRF1 inhibition by STELLA for cancer therapy. Bai, W., Xu, J., Gu, W. et al. Nat Commun (2025) 16:474-474. DOI 10.1038/s41467-024-55481-7 · PubMed
Other PDB entries of the same protein (UniProt Q96T88 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8XV4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.