8XWN: CXCR2

Structure of CXCR2 bound to CXCL8 (Ligand-receptor focused map). Determined by electron microscopy at 3.29 Å resolution. Released 15 Jan 2025.

Method: Electron microscopy
Resolution: 3.29 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,496
Mol. weight: 64.95 kDa
Released: 15 Jan 2025

Explore 8XWN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XWN contains 20 α-helices and 10 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	2
α-helix	26-28	3
β-strand	29-35	7	3
β-strand	45-50	6	3
β-strand	55-58	4	3
α-helix	63-77	15

Chain E: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	26-28	3
β-strand	29-35	7	3
β-strand	45-50	6	3
β-strand	55-58	4	3
α-helix	63-76	14

Chain R: 16 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	40-42	3
α-helix	46-75	30
α-helix	82-110	29
α-helix	116-148	33
α-helix	155-159	5
α-helix	162-176	15
α-helix	178-182	5
β-strand	184-187	4	1
β-strand	192	1	2
β-strand	195-198	4	1
α-helix	204-211	8
α-helix	213-216	4
α-helix	217-221	5
α-helix	222-240	19
α-helix	246-278	33
α-helix	286-303	18
α-helix	306-310	5
α-helix	311-315	5
α-helix	319-328	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-X-C chemokine receptor type 2	R	protein	416	Homo sapiens	P25025 (AlphaFold model)
MDNCF-a	D, E	protein	79	Homo sapiens	P10145 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>8XWN_1 C-X-C chemokine receptor type 2 (chains R)
MGKTIIALSYIFCLVFADYKDDDDAANFTPVNGSSGNQSVRLVTSSSLEVLFQGPGSEDF
NMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSLL
GNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSL
LKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFR
RTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMG
QKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATEILGI
LHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL

Sequence of entity 2 (D, E), FASTA

>8XWN_2 MDNCF-a (chains D, E)
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDP
KENWVQRVVEKFLKRAENS

Primary citation

Molecular basis of promiscuous chemokine binding and structural mimicry at the C-X-C chemokine receptor, CXCR2. Saha, S., Sano, F.K., Sharma, S. et al. Mol Cell (2025) 85:976-988.e9. DOI 10.1016/j.molcel.2025.01.024 · PubMed

Other PDB entries of the same protein (UniProt P25025 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KVA 2.2 Å, Structure of anti-hCXCR2 abN48-2 in complex with its CXCR2 epitope
6KVF 2.79 Å, Structure of anti-hCXCR2 abN48 in complex with its CXCR2 epitope
8XXH 2.8 Å, Structure of CXCR2 bound to CXCL2 (CXCR2-CXCL2-Go Full map)
8XX6 2.99 Å, Structure of CXCR2 bound to CXCL8 (CXCR2-CXCL8-Go Full map)
8XWS 3.06 Å, Structure of CXCR2 bound to CXCL5 (Ligand-receptor focused map)
8XWV 3.07 Å, Structure of CXCR2 bound to CXCL1 (CXCR2-CXCL1-Go Full map)
8XVU 3.09 Å, Structure of CXCR2 bound to CXCL2 (Ligand-receptor focused map)
8XXR 3.17 Å, Structure of CXCR2 bound to CXCL6 (CXCR2-CXCL6-Go Full map)
8XXX 3.17 Å, Structure of CXCR2 bound to CXCL6 (Composite map)
6LFL 3.2 Å, Crystal structure of a class A GPCR
8XX7 3.32 Å, Structure of CXCR2 bound to CXCL5 (CXCR2-CXCL5-Go Full map)
8XX3 3.38 Å, Structure of CXCR2 bound to CXCL3 (CXCR2-CXCL3-Go Full map)

Browse structure collections

About this viewer

MolViewer shows 8XWN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.