8YCM: Monomeric Human STK19

Monomeric Human STK19. Determined by X-ray diffraction at 1.32 Å resolution. Released 6 Mar 2024.

Method: X-ray diffraction
Resolution: 1.32 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,968
Mol. weight: 50.7 kDa
Released: 6 Mar 2024

Explore 8YCM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YCM contains 33 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	35-46	12
α-helix	49-52	4
β-strand	60-61	2	1
α-helix	62-68	7
α-helix	72-84	13
β-strand	88-95	8	1
β-strand	98-104	7	1
α-helix	105-115	11
α-helix	122-127	6
α-helix	128-132	5
α-helix	133-135	3
β-strand	140-142	3	2
α-helix	143-144	2
α-helix	145-149	5
α-helix	154-163	10
β-strand	166-170	5	2
β-strand	173-176	4	2
α-helix	181-201	21
α-helix	203-205	3
β-strand	206-208	3	3
α-helix	209-213	5
α-helix	216-218	3
α-helix	225-235	11
β-strand	239-244	6	3
β-strand	246-250	5	3

Chain B: 17 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	35-44	10
α-helix	49-52	4
α-helix	57-58	2
β-strand	60-61	2	4
α-helix	62-68	7
α-helix	72-85	14
β-strand	88-92	5	4
β-strand	100-104	5	4
α-helix	105-116	12
α-helix	122-127	6
α-helix	128-132	5
α-helix	133-135	3
β-strand	140-142	3	5
α-helix	143-144	2
α-helix	145-149	5
α-helix	154-163	10
β-strand	166-170	5	5
β-strand	173-176	4	5
α-helix	181-201	21
α-helix	203-205	3
β-strand	206-208	3	6
α-helix	209-213	5
α-helix	216-218	3
α-helix	225-234	10
β-strand	239-243	5	6
β-strand	246-250	5	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 4 of Inactive serine/threonine-protein kinase 19	A, B	protein	229	Homo sapiens	P49842 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8YCM_1 Isoform 4 of Inactive serine/threonine-protein kinase 19 (chains A, B)
GPLGSGEPGSARAAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQ
GEIRIVQLGFDLDAHGIIFTEDYRTRVLKASDGRPYAGAVQKFLASVLPASGDLSFQQDQ
MTQTFGFRDSEITHLVNAGVLTVRDAGSWWLAVPGAGRFIKYFVKGRQAVLSMVRKAKYR
ELLLSELLGRRAPVVVRLGLTYHVHDLIGAQLVDSISTTSGTLLRLPET

Primary citation

Mutations found in cancer patients compromise DNA binding of the winged helix protein STK19. Li, J., Ma, X., Wang, X. et al. Sci Rep (2024) 14:14098-14098. DOI 10.1038/s41598-024-64840-9 · PubMed

Other PDB entries of the same protein (UniProt P49842 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7XRB 1.65 Å, human STK19 dimer
9BZ0 1.9 Å, Structure of an STK19-containing TC-NER complex
9ER2 3.3 Å, PolII-TCR-STK19 structure.
9FD2 3.4 Å, Structure of Pol II-TC-NER-STK19 complex

Browse structure collections

About this viewer

MolViewer shows 8YCM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.