9ER2: PolII-TCR-STK19 structure

Name: PDB 9ER2: PolII-TCR-STK19 structure.
Published: 2024-12-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

PolII-TCR-STK19 structure. Determined by electron microscopy at 3.3 Å resolution. Released 4 Dec 2024.

Method: Electron microscopy
Resolution: 3.3 Å
Organisms: Homo sapiens, Sus scrofa
Chains: 22
Atoms: 50,649
Mol. weight: 1093.17 kDa
Ligands: BEF, ADP, MG, ZN
Released: 4 Dec 2024

Explore 9ER2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ER2 contains 257 α-helices and 378 β-strands across 19 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 4 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	2-9	8
α-helix	15-28	14
β-strand	30-32	3	94
β-strand	38	1	95
α-helix	39-40	2
β-strand	46-51	6	96
β-strand	58-63	6	96
β-strand	68-72	5	96
β-strand	84	1	95
β-strand	86-90	5	96
β-strand	102-107	6	97
α-helix	108	1
β-strand	115-119	5	97
β-strand	123-127	5	97
β-strand	137-139	3	97
β-strand	144-149	6	98
β-strand	158-163	6	98
β-strand	168-172	5	98
β-strand	181-182	2	98
β-strand	189-194	6	99
β-strand	201-206	6	99
β-strand	210-215	6	99
β-strand	222-225	4	99
β-strand	248	1	100
β-strand	252	1	100
β-strand	259-264	6	100
β-strand	268-273	6	100
β-strand	279	1	100
β-strand	298-299	2	101
β-strand	307-312	6	101
β-strand	315-320	6	101
β-strand	326-330	5	101
β-strand	337-343	7	94
β-strand	348-353	6	94
β-strand	358-363	6	94

Chain A: 73 helices, 68 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15	1	4
β-strand	20-22	3	5
α-helix	23	1
β-strand	25	1	6
α-helix	26-27	2
α-helix	28-33	6
β-strand	47	1	7
β-strand	52	1	7
α-helix	53	1
β-strand	86-95	10	8
α-helix	100-108	9
α-helix	124-132	9
α-helix	137-148	12
β-strand	190-194	5	9
β-strand	197-201	5	9
β-strand	214-216	3	9
α-helix	218-226	9
α-helix	230-236	7
β-strand	249-255	7	8
α-helix	264-266	3
α-helix	275-295	21
α-helix	300-318	19
α-helix	326-328	3
β-strand	329	1	10
α-helix	331-333	3
β-strand	335	1	10
α-helix	349-353	5
β-strand	357-359	3	11
β-strand	362-369	8	12
β-strand	377-381	5	12
α-helix	382-387	6
β-strand	389-393	5	13
α-helix	394	1
α-helix	399-408	10
β-strand	416-420	5	13
β-strand	426	1	13
β-strand	445-449	5	13
α-helix	450	1
β-strand	455-459	5	12
α-helix	466-468	3
β-strand	469-477	9	12
β-strand	482-484	3	12
α-helix	487-489	3
β-strand	500-504	5	12
α-helix	509-518	10
β-strand	520	1	12
α-helix	522-524	3
β-strand	526	1	14
β-strand	533	1	14
α-helix	539-548	10
β-strand	554-555	2	15
α-helix	557-564	8
α-helix	574	1
β-strand	575	1	16
α-helix	576-577	2
β-strand	579-581	3	17
β-strand	585	1	17
β-strand	586-587	2	15
α-helix	588-595	8
β-strand	602-603	2	18
α-helix	611-614	4
β-strand	629-630	2	18
β-strand	635-637	3	18
α-helix	642-645	4
α-helix	652-659	8
α-helix	663-683	21
α-helix	696-721	26
α-helix	727-728	2
α-helix	733-759	27
α-helix	765-771	7
α-helix	778-781	4
α-helix	782-786	5
β-strand	789-790	2	19
α-helix	798-799	2
β-strand	800	1	20
α-helix	817-820	4
β-strand	822-823	2	19
α-helix	833-852	20
α-helix	854-868	15
β-strand	872-873	2	21
β-strand	879-880	2	21
β-strand	886-888	3	21
α-helix	891-893	3
β-strand	896	1	22
β-strand	902-905	4	23
α-helix	913-920	8
α-helix	927-933	7
β-strand	934	1	24
α-helix	936-944	9
α-helix	947-969	23
β-strand	976-979	4	23
α-helix	983-993	11
β-strand	1002	1	24
α-helix	1006-1019	14
α-helix	1028-1037	10
α-helix	1039-1048	10
α-helix	1053-1056	4
α-helix	1062-1077	16
β-strand	1080	1	22
α-helix	1081-1082	2
α-helix	1087-1101	15
α-helix	1120-1128	9
β-strand	1139-1142	4	25
β-strand	1143	1	26
α-helix	1146-1148	3
α-helix	1151-1161	11
β-strand	1165	1	27
α-helix	1167-1169	3
β-strand	1172-1176	5	28
β-strand	1177	1	29
α-helix	1190-1197	8
β-strand	1207	1	30
β-strand	1210	1	29
β-strand	1213-1216	4	28
α-helix	1218-1223	6
α-helix	1228-1239	12
β-strand	1246-1247	2	28
β-strand	1255-1258	4	28
β-strand	1262	1	30
α-helix	1281-1295	15
β-strand	1297	1	27
β-strand	1307	1	31
β-strand	1310	1	25
β-strand	1319-1322	4	32
β-strand	1328-1331	4	32
β-strand	1335-1337	3	25
β-strand	1338	1	31
α-helix	1343-1347	5
β-strand	1352	1	26
β-strand	1358-1359	2	25
α-helix	1362-1369	8
α-helix	1371-1386	16
α-helix	1387-1389	3
α-helix	1395-1404	10
α-helix	1426-1432	7
α-helix	1435-1444	10
β-strand	1448-1449	2	5
α-helix	1454-1458	5
α-helix	1467-1469	3
β-strand	1472-1475	4	33

Chain b: 28 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	491-492	2	91
β-strand	498-499	2	91
α-helix	501-506	6
α-helix	509-524	16
β-strand	528-530	3	92
α-helix	532-533	2
α-helix	539-552	14
β-strand	569-572	4	92
α-helix	575-577	3
α-helix	578-588	11
β-strand	594-597	4	92
α-helix	607-617	11
β-strand	620-623	4	92
α-helix	625-635	11
β-strand	644-646	3	92
α-helix	648-652	5
α-helix	657-662	6
β-strand	671-673	3	92
α-helix	682-692	11
α-helix	700-703	4
α-helix	704-708	5
α-helix	709-713	5
α-helix	721-738	18
α-helix	739-741	3
β-strand	742-743	2	92
β-strand	759-760	2	93
β-strand	763-766	4	93
α-helix	770-780	11
α-helix	783-789	7
α-helix	795-807	13
α-helix	835-837	3
α-helix	839-853	15
β-strand	858-862	5	93
α-helix	865-877	13
β-strand	884-885	2	93
α-helix	891-903	13
β-strand	909-913	5	93
α-helix	914-917	4
β-strand	928-931	4	93
α-helix	938-946	9
β-strand	957-964	8	93
α-helix	968-987	20
α-helix	992-995	4
α-helix	1388-1397	10

Chain B: 55 helices, 87 β-strands

Element	Residues	Length	Sheet
α-helix	22-36	15
α-helix	41-49	9
α-helix	50-54	5
α-helix	55-61	7
α-helix	63-64	2
β-strand	67-68	2	34
β-strand	83-84	2	34
β-strand	87-93	7	35
α-helix	94-96	3
β-strand	97-99	3	36
β-strand	105-107	3	36
α-helix	110-116	7
β-strand	121-129	9	35
β-strand	130-133	4	34
β-strand	139-142	4	34
β-strand	147-153	7	35
α-helix	168-173	6
β-strand	185-186	2	37
β-strand	191-193	3	37
β-strand	197	1	38
β-strand	200	1	39
α-helix	201	1
β-strand	205-208	4	40
β-strand	215-221	7	40
β-strand	223	1	41
β-strand	233	1	41
β-strand	236-240	5	40
β-strand	256-259	4	40
β-strand	267-268	2	40
α-helix	269-274	6
α-helix	281-288	8
α-helix	295-307	13
α-helix	314-323	10
α-helix	332-341	10
α-helix	342-346	5
α-helix	349-351	3
α-helix	358-377	20
α-helix	381-384	4
α-helix	388-390	3
β-strand	391	1	39
β-strand	394	1	38
α-helix	396-424	29
α-helix	431-434	4
α-helix	438-450	13
β-strand	453	1	42
β-strand	463	1	42
β-strand	468-469	2	37
α-helix	470-471	2
α-helix	475-482	8
β-strand	484	1	43
α-helix	497-499	3
α-helix	501-502	2
α-helix	503-505	3
β-strand	509	1	44
β-strand	525	1	43
β-strand	526	1	44
β-strand	531-532	2	45
α-helix	539-547	9
α-helix	553-555	3
α-helix	560-562	3
β-strand	565-569	5	46
β-strand	572-577	6	46
α-helix	580-592	13
β-strand	602-605	4	46
β-strand	611-615	5	46
β-strand	621-627	7	45
β-strand	628	1	47
β-strand	633	1	47
α-helix	637-644	8
α-helix	654-658	5
β-strand	662-666	5	45
α-helix	669-672	4
β-strand	675-676	2	45
β-strand	695-696	2	45
α-helix	700-703	4
α-helix	714-716	3
β-strand	717	1	48
α-helix	719-728	10
β-strand	732	1	49
β-strand	734	1	50
α-helix	740-742	3
β-strand	747-751	5	50
β-strand	755	1	51
β-strand	759-760	2	52
α-helix	762-765	4
β-strand	776-782	7	53
β-strand	793-797	5	53
α-helix	798-801	4
β-strand	808-817	10	50
β-strand	822	1	54
β-strand	825	1	54
β-strand	829	1	55
β-strand	853	1	56
α-helix	854-855	2
β-strand	859	1	50
β-strand	865-867	3	56
β-strand	869	1	55
β-strand	870-871	2	57
α-helix	872-873	2
β-strand	890-891	2	57
α-helix	893	1
β-strand	894-895	2	56
α-helix	896	1
β-strand	903-911	9	50
β-strand	917-927	11	50
β-strand	934-937	4	53
β-strand	942-949	8	53
α-helix	951-953	3
β-strand	956	1	58
β-strand	965-967	3	53
β-strand	977	1	48
α-helix	978-993	16
β-strand	997-998	2	52
α-helix	1008-1016	9
β-strand	1025-1026	2	53
β-strand	1029	1	58
α-helix	1035	1
β-strand	1036	1	58
α-helix	1037	1
α-helix	1040	1
β-strand	1041-1050	10	53
β-strand	1051	1	49
α-helix	1055-1057	3
β-strand	1060-1062	3	12
β-strand	1067	1	59
β-strand	1074	1	59
β-strand	1076	1	60
β-strand	1083	1	60
β-strand	1084-1086	3	11
α-helix	1088-1097	10
α-helix	1100-1104	5
α-helix	1105-1109	5
β-strand	1115-1119	5	4
β-strand	1125	1	4
β-strand	1127-1129	3	61
β-strand	1134-1136	3	61
β-strand	1137	1	62
β-strand	1142	1	62
β-strand	1146-1150	5	4
α-helix	1153-1163	11
β-strand	1167	1	6
β-strand	1170-1172	3	5

Chain c: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	570	1	87
α-helix	575	1
β-strand	576	1	87
α-helix	577	1
β-strand	584-585	2	88
β-strand	589-590	2	88
β-strand	594	1	89
β-strand	600	1	89
α-helix	603-618	16
α-helix	662-665	4
α-helix	668-676	9
α-helix	679-697	19
β-strand	703	1	20

Chain C: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	10-14	5	63
β-strand	18-23	6	63
α-helix	28-40	13
β-strand	43-49	7	64
β-strand	50	1	65
β-strand	52-55	4	64
α-helix	61-69	9
β-strand	73	1	66
β-strand	99-106	8	64
β-strand	113-115	3	67
α-helix	117-119	3
α-helix	120	1
β-strand	121-122	2	64
β-strand	129	1	66
β-strand	151-153	3	67
β-strand	158-169	12	64
α-helix	174-176	3
β-strand	179-186	8	63
α-helix	204-206	3
α-helix	218-220	3
β-strand	229-235	7	63
α-helix	241-269	29

Chain d: 10 helices, 68 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	102
β-strand	15-21	7	103
β-strand	30-35	6	103
β-strand	38-44	7	103
β-strand	49-56	8	103
β-strand	61-67	7	104
β-strand	76-81	6	104
β-strand	85-94	10	104
β-strand	97-107	11	104
β-strand	115	1	105
β-strand	121-124	4	106
β-strand	130-134	5	106
β-strand	136	1	105
β-strand	141-144	4	106
β-strand	155-156	2	106
β-strand	164-169	6	107
α-helix	170	1
β-strand	177-184	8	107
β-strand	187-196	10	107
β-strand	201-204	4	107
β-strand	210-211	2	107
β-strand	218-221	4	108
β-strand	229-232	4	108
β-strand	237-240	4	108
β-strand	245-248	4	108
α-helix	251-253	3
β-strand	258-263	6	109
β-strand	270-275	6	109
β-strand	279-288	10	109
β-strand	296-307	12	109
β-strand	313-318	6	110
β-strand	321-325	5	110
β-strand	331-336	6	110
β-strand	347-353	7	110
β-strand	362-365	4	111
α-helix	367-369	3
β-strand	374-378	5	111
β-strand	386-392	7	111
β-strand	710-712	3	111
β-strand	715-716	2	111
β-strand	720-727	8	112
β-strand	732-741	10	112
β-strand	751	1	112
α-helix	757-759	3
β-strand	763-765	3	112
β-strand	786-795	10	112
β-strand	801-806	6	112
β-strand	811-820	10	113
β-strand	827-835	9	113
β-strand	846-854	9	113
β-strand	857-866	10	113
β-strand	872-876	5	114
β-strand	879-883	5	114
β-strand	888-893	6	114
β-strand	899-905	7	114
β-strand	911-917	7	115
β-strand	920-925	6	115
β-strand	932-936	5	115
β-strand	941-946	6	115
β-strand	947	1	116
β-strand	954-959	6	117
β-strand	964-969	6	117
β-strand	973-978	6	117
α-helix	987-990	4
β-strand	991	1	116
β-strand	993-998	6	117
β-strand	1004-1009	6	102
β-strand	1028-1032	5	102
β-strand	1037-1042	6	102
α-helix	1045-1061	17
α-helix	1070-1074	5
β-strand	1076-1078	3	118
β-strand	1081-1083	3	118
β-strand	1086	1	117
β-strand	1088-1089	2	102
α-helix	1091-1095	5
α-helix	1102-1108	7
α-helix	1126-1138	13

Chain D: 11 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	68
β-strand	21	1	68
α-helix	24-26	3
α-helix	29	1
β-strand	30-31	2	33
α-helix	34-49	16
α-helix	55-58	4
α-helix	59-70	12
α-helix	77-89	13
α-helix	94-103	10
α-helix	108-114	7
α-helix	116-118	3
α-helix	124-137	14
α-helix	139-140	2

11 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA (5'-r(pcpapapapapupcpgpapgpapgpgpa)-3')	P	RNA	14	Homo sapiens
Isoform 1 of Inactive serine/threonine-protein kinase 19	Q	protein	258	Homo sapiens	P49842 (AlphaFold model)
DNA-directed RNA polymerase subunit	A	protein	1984	Sus scrofa	A0A7M4DUC2
DNA-directed RNA polymerase subunit beta	B	protein	1167	Sus scrofa	I3LGP4 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C	protein	275	Sus scrofa	I3LCH3 (AlphaFold model)
RNA polymerase II subunit D	D	protein	142	Sus scrofa	A0A287ADR4
DNA-directed RNA polymerase II subunit E	E	protein	210	Sus scrofa	I3LSI7
DNA-directed RNA polymerases I, II, and III subunit RPABC2	F	protein	127	Sus scrofa	A0A4X1VEK9
DNA-directed RNA polymerase subunit	G	protein	172	Sus scrofa	A0A4X1VKG7
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	150	Sus scrofa	I3LCB2
DNA-directed RNA polymerase II subunit RPB9	I	protein	125	Sus scrofa	P60899
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	67	Sus scrofa	A0A8W4F9W9

9 more molecules are not listed.

Sequence of entity 1 (P), FASTA

>9ER2_1 RNA (5'-R(P*CP*AP*AP*AP*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3') (chains P)
CAAAAUCGAGAGGA

Sequence of entity 2 (Q), FASTA

>9ER2_2 Isoform 1 of Inactive serine/threonine-protein kinase 19 (chains Q)
MSWKRHHLIPETFGVKRRRKRGPVESDPLRGEPGSARAAVSELMQLFPRGLFEDALPPIV
LRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTRVCDCVLKAC
DGRPYAGAVQKFLASVLPACGDLSFQQDQMTQTFGFRDSEITHLVNAGVLTVRDAGSWWL
AVPGAGRFIKYFVKGRQAVLSMVRKAKYRELLLSELLGRRAPVVVRLGLTYHVHDLIGAQ
LVDCISTTSGTLLRLPET

Sequence of entity 3 (A), FASTA

>9ER2_3 DNA-directed RNA polymerase subunit (chains A)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPT
SPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSY
SPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTS
PKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDS
DEEN

Sequence of entity 4 (B), FASTA

>9ER2_4 DNA-directed RNA polymerase subunit beta (chains B)
MQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDL
QAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVD
ITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFII
NGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGA
KKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDE
AFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGY
MVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGK
DFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNS
PIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEE
WSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDI
REREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDT
LEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSA
MGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTG
YNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDK
LDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSETGIVDQV
MVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIII
NPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEV
LYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFG
EMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQIS
LVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 5 (C), FASTA

>9ER2_5 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Sequence of entity 6 (D), FASTA

>9ER2_6 RNA polymerase II subunit D (chains D)
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY

Sequence of entity 7 (E), FASTA

>9ER2_7 DNA-directed RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 8 (F), FASTA

>9ER2_8 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD

Sequence of entity 9 (G), FASTA

>9ER2_9 DNA-directed RNA polymerase subunit (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Sequence of entity 10 (H), FASTA

>9ER2_10 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Sequence of entity 11 (I), FASTA

>9ER2_11 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Sequence of entity 12 (J), FASTA

>9ER2_12 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK

Ligands and cofactors

ID	Name	Formula	Copies
BEF	Beryllium trifluoride ion	Be F3	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
MG	Magnesium ion	Mg	2
ZN	Zinc ion	Zn	11

Primary citation

STK19 facilitates the clearance of lesion-stalled RNAPII during transcription-coupled DNA repair. van den Heuvel, D., Rodriguez-Martinez, M., van der Meer, P.J. et al. Cell (2024) 187:7107. DOI 10.1016/j.cell.2024.10.018 · PubMed

Other PDB entries of the same protein (UniProt P49842 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8YCM 1.32 Å, Monomeric Human STK19
7XRB 1.65 Å, human STK19 dimer
9BZ0 1.9 Å, Structure of an STK19-containing TC-NER complex
9FD2 3.4 Å, Structure of Pol II-TC-NER-STK19 complex

Browse structure collections

About this viewer

MolViewer shows 9ER2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.