8ZJF: Human integrin alpha-E beta-7

Cryo-EM structure of human integrin alpha-E beta-7. Determined by electron microscopy at 2.7 Å resolution. Released 5 Jun 2024.

Method: Electron microscopy
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 10,917
Mol. weight: 223.18 kDa
Ligands: MG, CA
Released: 5 Jun 2024

Explore 8ZJF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZJF contains 50 α-helices and 106 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 75 β-strands

Element	Residues	Length	Sheet
β-strand	21-28	8	11
β-strand	37	1	12
β-strand	39-40	2	13
β-strand	43-45	3	14
β-strand	50-52	3	14
β-strand	55-56	2	13
β-strand	67-72	6	13
β-strand	77-81	5	13
α-helix	82	1
α-helix	86-88	3
β-strand	95-100	6	15
β-strand	103-113	11	15
β-strand	120-129	10	15
β-strand	135-140	6	15
α-helix	144-146	3
β-strand	148	1	16
β-strand	201-208	8	17
α-helix	215-235	21
β-strand	239-246	8	17
β-strand	251-252	2	17
α-helix	258-260	3
α-helix	262-270	9
α-helix	281-287	7
α-helix	288-292	5
α-helix	295-297	3
β-strand	304-310	7	17
α-helix	322-326	5
α-helix	329-331	3
β-strand	335-339	5	17
α-helix	343-347	5
α-helix	350-357	8
β-strand	366-367	2	17
α-helix	372-374	3
α-helix	375-384	10
α-helix	390-392	3
β-strand	404-410	7	16
β-strand	415-420	6	16
α-helix	423-426	4
β-strand	428	1	18
β-strand	430-434	5	16
β-strand	439-443	5	16
α-helix	451-455	5
β-strand	461	1	18
β-strand	464-469	6	19
β-strand	474-480	7	19
α-helix	483-485	3
β-strand	487	1	20
β-strand	488-495	8	19
β-strand	498-506	9	19
β-strand	514	1	20
β-strand	517-521	5	21
β-strand	531-536	6	21
β-strand	544-546	3	22
β-strand	547-553	7	21
α-helix	554	1
β-strand	560-566	7	21
β-strand	574-577	4	22
β-strand	580-583	4	23
β-strand	595-599	5	23
α-helix	607-609	3
β-strand	614-618	5	23
β-strand	621	1	24
β-strand	624	1	24
β-strand	631-634	4	23
α-helix	635-637	3
β-strand	648-653	6	11
β-strand	662-666	5	11
β-strand	669	1	12
β-strand	671-676	6	11
α-helix	677-678	2
β-strand	679-680	2	25
β-strand	682-683	2	26
β-strand	693	1	27
α-helix	700	1
β-strand	701-703	3	28
β-strand	706-709	4	26
β-strand	724-727	4	29
β-strand	729-731	3	30
β-strand	741-742	2	28
α-helix	745-747	3
β-strand	751-754	4	29
β-strand	760-762	3	26
β-strand	765-768	4	28
α-helix	782	1
β-strand	783-787	5	30
β-strand	791-792	2	29
α-helix	801-803	3
β-strand	804-805	2	25
β-strand	815-817	3	30
β-strand	819	1	27
β-strand	833-835	3	31
β-strand	838-839	2	32
β-strand	852-856	5	32
β-strand	858-860	3	31
β-strand	868-869	2	33
β-strand	872-873	2	34
β-strand	878-884	7	32
α-helix	895-898	4
β-strand	918	1	31
β-strand	921-927	7	32
β-strand	940-943	4	34
β-strand	944-945	2	33
β-strand	953-955	3	34

Chain B: 22 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	51-57	7
β-strand	64	1	1
α-helix	84-87	4
β-strand	96	1	1
β-strand	102-107	6	2
β-strand	113	1	3
β-strand	120	1	3
β-strand	123-124	2	4
β-strand	127-132	6	2
β-strand	138-145	8	4
β-strand	149	1	5
β-strand	152-159	8	6
α-helix	165-171	7
α-helix	175-182	8
β-strand	186	1	5
β-strand	189-196	8	6
α-helix	209-213	5
β-strand	223	1	7
β-strand	230-236	7	6
α-helix	239-248	10
β-strand	251	1	7
β-strand	259	1	8
α-helix	261-270	10
α-helix	272-275	4
β-strand	281-288	8	6
β-strand	292	1	8
α-helix	295-301	7
α-helix	306-307	2
β-strand	318	1	6
α-helix	320-322	3
α-helix	326-329	4
α-helix	330-339	10
β-strand	342-348	7	6
α-helix	350-352	3
α-helix	353-361	9
β-strand	367-370	4	6
α-helix	378-390	13
β-strand	393	1	9
β-strand	395-396	2	2
α-helix	400-401	2
β-strand	404-407	4	4
β-strand	410-411	2	4
β-strand	428	1	9
α-helix	431-432	2
α-helix	435	1
β-strand	436-445	10	4
β-strand	453-459	7	2
β-strand	465-472	8	2
α-helix	500-503	4
α-helix	516-519	4
α-helix	522-525	4
β-strand	543-544	2	10
β-strand	547-548	2	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin beta-7	B	protein	826	Homo sapiens	P26010 (AlphaFold model)
Integrin alpha-E	A	protein	1198	Homo sapiens	P38570 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>8ZJF_1 Integrin beta-7 (chains B)
VALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPSC
AWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGAT
QLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLVR
LQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQA
FEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKLG
GIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELSK
LIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREGK
AEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSDT
QPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGKG
HCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSGD
MDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTGP
LATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKGA
DHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKSA
ITTTINPRFQEADSPTLGSGSGLNDIFEAQKIEWHEGSGSENLYFQ

Sequence of entity 2 (A), FASTA

>8ZJF_2 Integrin alpha-E (chains A)
WLFHTLLCIASLALLAAFNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRTK
RTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSE
LTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRALE
KEEEEDKEEEEDEEEEEAGTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECNF
ALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTKTASAMQHVLDSIFTSSHGSRR
KASKVMVVLTDGGIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSARTARELNLIASDP
DETHAFKVTNYMALDGLLSKLRYNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGAV
GAFDWSGGALLYDTRSRRGRFLNQTAAAAADAEAAQYSYLGYAVAVLHKTCSLSYIAGAP
RYKHHGAVFELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGSTDFLLVAAPFYHV
HGEEGRVYVYRLSEQDGSFSLARILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAPL
EGFGADDGASFGSVYIYNGHWDGLSASPSQRIRASTVAPGLQYFGMSMAGGFDISGDGLA
DITVGTLGQAVVFRSRPVVRLKVSMAFTPSALPIGFNGVVNVRLCFEISSVTTASESGLR
EALLNFTLDVDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPTEGELCEEDCFS
NASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVSQ
QELVVGLTKELTLNINLTNSGEDSYMTSMALNYPRNLQLKRMQKPPSPNIQCDDPQPVAS
VLIMNCRIGHPVLKRSSAHVSVVWQLEENAFPNRTADITVTVTNSNERRSLANETHTLQF
RHGFVAVLSKPSIMYVNTGQGLSHHKEFLFHVHGENLFGAEYQLQICVPTKLRGLQVVAV
KKLTRTQASTVCTWSQERACAYSSVQHVEEWHSVSCVIASDKENVTVAAEISWDHSEELL
KDVTELQILGEISFNKSLYEGLNAENHRTKITVVFLKDEKYHSLPIIIKGSVGGLLVLIV
ILVILFKCGFFKRKYQQLNLESIRKAQLKSENLLEEENLELEVLFQGPGSDYKDDDDK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
CA	Calcium ion	Ca	2

Primary citation

Cryo-EM structure of I domain-containing integrin alpha E beta 7. Akasaka, H., Sato, D., Shihoya, W. et al. Biochem Biophys Res Commun (2024) 721:150121-150121. DOI 10.1016/j.bbrc.2024.150121 · PubMed

Other PDB entries of the same protein (UniProt P26010 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
9P97 2.92 Å, CryoEM structure of the closed integrin alphaEbeta7 bound to fab LF61
9P98 2.93 Å, CryoEM structure of the open integrin alphaEbeta7 bound to fab LF61
9P95 3.05 Å, CryoEM structure of integrin alpha4beta7 bound to MAdCAM-1
3V4V 3.1 Å, crystal structure of a4b7 headpiece complexed with Fab ACT-1 and RO0505376
9P96 3.1 Å, CryoEM structure of the apo integrin alpha4beta7
3V4P 3.15 Å, crystal structure of a4b7 headpiece complexed with Fab ACT-1
9P99 3.37 Å, CryoEM structure of integrin alphaEbeta7 bound to E-cadherin

Browse structure collections

About this viewer

MolViewer shows 8ZJF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.