9BKU: TRPV3 K169A in nanodiscs incubated with NASPM

Cryo-EM structure of TRPV3 K169A in nanodiscs incubated with NASPM. Determined by electron microscopy at 3.39 Å resolution. Released 21 May 2025.

Method: Electron microscopy
Resolution: 3.39 Å
Organism: Homo sapiens
Chains: 4
Atoms: 17,504
Mol. weight: 392.6 kDa
Ligands: 6OU
Released: 21 May 2025

Explore 9BKU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9BKU contains 144 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 36 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	118-129	12
α-helix	132-146	15
α-helix	159-162	4
β-strand	164	1	1
β-strand	169	1	1
α-helix	171-177	7
α-helix	183-196	14
α-helix	200-204	5
α-helix	218-224	7
α-helix	228-236	9
α-helix	255-257	3
α-helix	265-271	7
α-helix	275-283	9
α-helix	299-306	8
α-helix	316-328	13
α-helix	332-335	4
α-helix	344-351	8
α-helix	354-361	8
α-helix	371-373	3
β-strand	376-382	7	2
β-strand	385-391	7	2
α-helix	403-409	7
α-helix	416-420	5
α-helix	426-432	7
α-helix	433-437	5
α-helix	438-460	23
α-helix	483-507	25
α-helix	521-541	21
α-helix	547-560	14
α-helix	561-567	7
α-helix	570-582	13
α-helix	583-587	5
α-helix	588-606	19
β-strand	609	1	3
α-helix	625-637	13
β-strand	648	1	3
α-helix	651-662	12
α-helix	663-670	8
α-helix	671-685	15
α-helix	689-706	18
α-helix	709-715	7
β-strand	719-720	2	2
β-strand	730-737	8	2
α-helix	739-746	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transient receptor potential cation channel subfamily V member 3	A, B, C, D	protein	799	Homo sapiens	Q8NET8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>9BKU_1 Transient receptor potential cation channel subfamily V member 3 (chains A, B, C, D)
MKAHPKEMVPLMGKRVAAPSGNPAVLPEKRPAEITPTKKSAHFFLEIEGFEPNPTVAKTS
PPVFSKPMDSNIRQCISGNCDDMDSPQSPQDDVTETPSNPNSPSAQLAKEEQRRKKRRLK
KRIFAAVSEGCVEELVELLVELQELCRRRHDEDVPDFLMHKLTASDTGATCLMKALLNIN
PNTKEIVRILLAFAEENDILGRFINAEYTEEAYEGQTALNIAIERRQGDIAALLIAAGAD
VNAHAKGAFFNPKYQHEGFYFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNIL
HALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETTRNNDGLTPLQLAAKMGKAEILKYI
LSREIKEKRLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDNSVLEITVYNTNIDNRHEML
TLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMG
WLQLLGRMFVLIWAMCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFIQAVLVILSVFLY
LFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFLLG
FGVALASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSKYPILFLFLLIT
YVILTFVLLLNMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGEL
CKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFE
EVEEFPETSVSNSLEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
6OU	[(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-y…	C39 H76 N O8 P	36

Primary citation

Molecular basis of TRPV3 channel blockade by intracellular polyamines. Zhang, J., Yuan, P., Nichols, C.G. et al. Commun Biol (2025) 8:727-727. DOI 10.1038/s42003-025-08103-x · PubMed

Other PDB entries of the same protein (UniProt Q8NET8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6H9J 1.83 Å, Factor Inhibiting HIF (FIH) in complex with zinc, NOG and TRPV3 (229-255)
6HA6 1.98 Å, Factor Inhibiting HIF (FIH) in complex with zinc, NOG and TRPV3 (220-246)
7QQN 2.45 Å, The PDZ domain of SNTG1 complexed with the acetylated PDZ-binding motif of TRPV3
8V6K 2.46 Å, Apo-state cryo-EM structure of human TRPV3 in cNW30 nanodiscs
13LU 2.49 Å, Structure of human TRPV3-W521S Olmsted syndrome mutant in the closed state
7XJ0 2.53 Å, Structure of human TRPV3 in complex with Trpvicin
8GKA 2.55 Å, Human TRPV3 tetramer structure, closed conformation
8V6N 2.59 Å, Open-state cryo-EM structure of human TRPV3 in presence of 2-APB in cNW30 nanodiscs
9PJ5 2.76 Å, Closed-state structure of wild-type human TRPV3 purified in GDN detergent
8V6O 2.83 Å, Inactivated-state cryo-EM structure of human TRPV3 in presence of 2-APB in cNW30 nanodiscs
13LJ 2.86 Å, Structure of human TRPV3-G568C Olmsted syndrome mutant in the closed state
7XJ1 2.93 Å, Structure of human TRPV3_G573S in complex with Trpvicin in C2 symmetry

Browse structure collections

About this viewer

MolViewer shows 9BKU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.