9CAQ: DNA replication licensing factor MCM2

Name: PDB 9CAQ: Cryo-EM structure of a human MCM2-7 double hexamer formed from independently loaded MCM2-7 single hexamers
Published: 2024-10-02
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: replication

Cryo-EM structure of a human MCM2-7 double hexamer formed from independently loaded MCM2-7 single hexamers. Determined by electron microscopy at 3.2 Å resolution. Released 2 Oct 2024.

Method: Electron microscopy
Resolution: 3.2 Å
Organisms: Homo sapiens, Saccharomyces cerevisiae
Chains: 14
Atoms: 60,375
Mol. weight: 1126.82 kDa
Ligands: MG, ZN, ADP, ATP
Released: 2 Oct 2024

Explore 9CAQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CAQ contains 325 α-helices and 361 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 2: 27 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	182-187	6
α-helix	189-205	17
α-helix	214-225	12
β-strand	229-233	5	1
α-helix	234-240	7
α-helix	242-250	9
α-helix	252-270	19
α-helix	272-276	5
β-strand	282-286	5	1
β-strand	291	1	2
β-strand	293	1	3
β-strand	296	1	3
α-helix	299-301	3
β-strand	304-315	12	2
α-helix	316-318	3
β-strand	319-329	11	2
β-strand	334-340	7	2
β-strand	362-363	2	2
β-strand	369-379	11	2
β-strand	393-399	7	2
β-strand	411-419	9	2
β-strand	434	1	4
β-strand	438-446	9	2
α-helix	460-468	9
α-helix	473-480	8
α-helix	489-500	12
β-strand	505	1	5
β-strand	513	1	5
β-strand	519-523	5	6
α-helix	529-539	11
β-strand	543-547	5	6
β-strand	559-560	2	7
β-strand	563	1	8
β-strand	568	1	8
β-strand	571-572	2	7
α-helix	575-578	4
β-strand	583-587	5	6
α-helix	594-606	13
β-strand	608-612	5	9
β-strand	617-621	5	9
β-strand	627-630	4	6
α-helix	631-632	2
α-helix	633-635	3
α-helix	643-646	4
α-helix	651-656	6
β-strand	659-663	5	6
α-helix	669-685	17
α-helix	717-725	9
α-helix	726-730	5
β-strand	734	1	10
α-helix	740-754	15
α-helix	764-781	18
β-strand	785	1	10
α-helix	788-805	18
α-helix	808-817	10
α-helix	819-823	5

Chain 3: 30 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	11
α-helix	10-23	14
α-helix	31-42	12
β-strand	46-50	5	12
α-helix	51-57	7
α-helix	59-67	9
α-helix	70-87	18
α-helix	89-92	4
β-strand	99-103	5	12
β-strand	110-111	2	13
α-helix	113-115	3
β-strand	124-134	11	13
β-strand	138-148	11	13
β-strand	153-158	6	13
α-helix	169-172	4
β-strand	177	1	14
α-helix	182	1
β-strand	183	1	14
α-helix	184	1
β-strand	185-202	18	13
β-strand	216-222	7	13
β-strand	234-243	10	13
α-helix	245-247	3
β-strand	251-252	2	15
β-strand	255	1	16
β-strand	258-267	10	13
α-helix	278-290	13
α-helix	295-302	8
α-helix	311-322	12
β-strand	327-328	2	17
β-strand	334-335	2	17
β-strand	340-345	6	18
α-helix	351-361	11
β-strand	365-368	4	18
β-strand	381-384	4	19
β-strand	391-394	4	19
α-helix	397-400	4
β-strand	405-409	5	18
α-helix	411-413	3
α-helix	416-421	6
α-helix	423-427	5
β-strand	430-434	5	20
β-strand	439-443	5	20
β-strand	447-452	6	18
α-helix	455-457	3
α-helix	465-468	4
α-helix	473-478	6
β-strand	481-485	5	18
α-helix	491-506	16
α-helix	567-575	9
β-strand	581-582	2	21
α-helix	583	1
α-helix	584-598	15
α-helix	600-602	3
α-helix	604	1
β-strand	608	1	22
α-helix	615-632	18
β-strand	636-637	2	21
α-helix	639-652	14
β-strand	655	1	22

Chain 4: 29 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	111-114	4
β-strand	126	1	23
β-strand	152	1	23
β-strand	155	1	23
α-helix	159-172	14
α-helix	192-203	12
β-strand	207-211	5	24
α-helix	212-218	7
α-helix	220-228	9
α-helix	230-247	18
β-strand	259-263	5	24
α-helix	271-273	3
α-helix	276-278	3
β-strand	282-292	11	25
α-helix	293-295	3
β-strand	298-306	9	26
β-strand	312-316	5	26
β-strand	321-324	4	27
β-strand	327	1	28
β-strand	334	1	28
β-strand	337-347	11	26
β-strand	349-356	8	25
β-strand	369-375	7	25
α-helix	376-378	3
β-strand	387-397	11	25
β-strand	400	1	29
β-strand	408-409	2	29
β-strand	411	1	30
β-strand	413-422	10	25
α-helix	432-436	5
α-helix	443-454	12
α-helix	458-465	8
α-helix	474-485	12
α-helix	493-495	3
β-strand	506-509	4	31
α-helix	516-526	11
β-strand	530-534	5	31
α-helix	540-544	5
β-strand	545-549	5	32
β-strand	556-560	5	32
α-helix	562-565	4
β-strand	570-574	5	31
α-helix	581-584	4
α-helix	586-593	8
β-strand	595-599	5	33
β-strand	604-608	5	33
β-strand	612-617	6	31
α-helix	620-622	3
α-helix	630-634	5
α-helix	638-643	6
β-strand	646-649	4	31
α-helix	651-653	3
α-helix	656-671	16
α-helix	684-696	13
β-strand	701-702	2	34
α-helix	704-720	17
α-helix	731-748	18
β-strand	752-753	2	34
α-helix	755-767	13

Chain 5: 23 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	35
α-helix	28-40	13
β-strand	43	1	36
β-strand	46	1	37
β-strand	50	1	37
β-strand	53	1	36
α-helix	54-65	12
β-strand	69-71	3	38
α-helix	74-80	7
α-helix	82-90	9
α-helix	92-110	19
β-strand	125-127	3	38
α-helix	133-136	4
α-helix	137-139	3
β-strand	148-158	11	39
β-strand	162-172	11	16
β-strand	178	1	16
β-strand	182-183	2	16
α-helix	184-185	2
β-strand	189	1	40
β-strand	191-192	2	15
α-helix	193-194	2
β-strand	196	1	41
β-strand	209	1	41
β-strand	212-224	13	16
β-strand	226-230	5	39
β-strand	244-248	5	39
β-strand	262-271	10	39
β-strand	273	1	40
β-strand	292-301	10	39
α-helix	316-327	12
α-helix	331-339	9
α-helix	347-358	12
β-strand	363-364	2	42
β-strand	370-371	2	42
β-strand	377-381	5	43
α-helix	387-397	11
β-strand	401-405	5	44
β-strand	409	1	45
β-strand	412	1	45
β-strand	417-420	4	46
β-strand	427-430	4	46
α-helix	433-436	4
β-strand	440-445	6	44
α-helix	447-449	3
α-helix	452-461	10
β-strand	467-469	3	47
β-strand	476-478	3	47
β-strand	482-484	3	44
β-strand	485-488	4	43
α-helix	497-499	3
α-helix	508-511	4
β-strand	516-520	5	43
α-helix	526-542	17
α-helix	556-569	14
α-helix	576-600	25
α-helix	610-627	18
α-helix	634-652	19

Chain 6: 30 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	21-36	16
α-helix	45-50	6
α-helix	51-54	4
β-strand	60-64	5	48
α-helix	65-71	7
α-helix	73-81	9
α-helix	83-101	19
β-strand	111-115	5	48
α-helix	128-130	3
β-strand	131	1	49
β-strand	135-144	10	49
α-helix	145-147	3
β-strand	148-158	11	4
α-helix	163	1
β-strand	164-169	6	4
α-helix	170	1
β-strand	191-193	3	4
β-strand	199-203	5	4
β-strand	204-209	6	49
α-helix	212-214	3
β-strand	223-228	6	49
β-strand	241-253	13	49
β-strand	263-266	4	27
α-helix	280-287	8
β-strand	290-291	2	27
β-strand	293-305	13	49
α-helix	323-328	6
α-helix	331-342	12
α-helix	346-354	9
α-helix	362-373	12
β-strand	378-379	2	50
β-strand	385-386	2	50
β-strand	392-396	5	51
α-helix	402-412	11
β-strand	416-420	5	51
α-helix	421-423	3
β-strand	424	1	33
α-helix	426-430	5
β-strand	431-435	5	52
β-strand	442-446	5	52
α-helix	448-451	4
β-strand	456-460	5	51
α-helix	462-464	3
α-helix	467-479	13
β-strand	481-486	6	53
β-strand	489-494	6	53
β-strand	498-503	6	51
α-helix	504-505	2
α-helix	516-519	4
α-helix	524-529	6
β-strand	532-536	5	51
α-helix	542-557	16
α-helix	569-579	11
β-strand	585-586	2	54
α-helix	588-605	18
β-strand	612	1	55
α-helix	618-634	17
β-strand	639-640	2	54
α-helix	642-655	14
β-strand	658	1	55

Chain 7: 26 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
α-helix	32-42	11
β-strand	47-51	5	56
α-helix	52-56	5
α-helix	60-68	9
α-helix	70-88	19
α-helix	98-112	15
β-strand	135-139	5	56
α-helix	140-141	2
α-helix	145-146	2
β-strand	147	1	30
α-helix	154-156	3
β-strand	160-170	11	30
β-strand	174-183	10	30
β-strand	190-194	5	30
β-strand	199-200	2	29
α-helix	201-203	3
β-strand	205	1	57
α-helix	209-214	6
β-strand	219	1	57
β-strand	221-238	18	30
α-helix	248-250	3
β-strand	252-258	7	30
β-strand	270-281	12	30
β-strand	293	1	13
β-strand	294-305	12	30
α-helix	307-309	3
α-helix	332-337	6
α-helix	348-359	12
β-strand	377-381	5	58
α-helix	387-397	11
β-strand	401-405	5	58
α-helix	406-408	3
β-strand	417-418	2	59
β-strand	429-430	2	59
α-helix	433-436	4
β-strand	440-445	6	58
α-helix	452-464	13
β-strand	466-469	4	60
β-strand	476-479	4	60
β-strand	482-488	7	58
α-helix	510-514	5
β-strand	517-521	5	58
α-helix	527-543	17
α-helix	552-555	4
α-helix	556-567	12
α-helix	578-593	16
α-helix	603-620	18
α-helix	627-642	16

Chain A: 24 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	182-187	6
α-helix	189-204	16
α-helix	214-225	12
β-strand	229-233	5	61
α-helix	234-240	7
α-helix	242-247	6
α-helix	252-270	19
α-helix	273-276	4
β-strand	282-286	5	61
β-strand	291	1	62
α-helix	294-296	3
β-strand	305-315	11	62
β-strand	319-329	11	62
β-strand	334-340	7	62
β-strand	361-379	19	62
β-strand	393-399	7	62
α-helix	400-402	3
β-strand	411-419	9	62
β-strand	434	1	63
β-strand	438-445	8	62
α-helix	459-469	11
α-helix	473-480	8
α-helix	489-500	12
β-strand	505	1	64
β-strand	513	1	64
β-strand	519-523	5	65
α-helix	529-539	11
β-strand	543-547	5	65
β-strand	559-562	4	66
β-strand	569-572	4	66
α-helix	575-578	4
β-strand	583-587	5	65
α-helix	589-591	3
α-helix	594-605	12
β-strand	608	1	67
β-strand	611	1	68
β-strand	618	1	68
β-strand	621	1	67
β-strand	625-630	6	65
α-helix	643-647	5
α-helix	651-655	5
β-strand	659-663	5	65
α-helix	669-685	17
α-helix	717-730	14
β-strand	734	1	69
α-helix	742-755	14
α-helix	764-781	18
β-strand	785	1	69
α-helix	788-805	18
α-helix	808-817	10

Chain B: 28 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	13
α-helix	10-24	15
α-helix	31-41	11
β-strand	46-50	5	70
α-helix	51-57	7
α-helix	59-67	9
α-helix	70-87	18
α-helix	90-94	5
β-strand	99-103	5	70
β-strand	110-111	2	71
α-helix	118-120	3
β-strand	123-127	5	71
β-strand	130-134	5	71
α-helix	135-137	3
β-strand	138-147	10	11
β-strand	154-158	5	11
β-strand	185-196	12	11
β-strand	197-202	6	71
α-helix	209	1
α-helix	213-215	3
β-strand	216-221	6	71
α-helix	226-228	3
β-strand	236-243	8	71
α-helix	244-246	3
β-strand	252	1	72
β-strand	255	1	73
β-strand	258-266	9	71
α-helix	278-290	13
α-helix	295-303	9
α-helix	311-322	12
β-strand	327-328	2	74
β-strand	334-335	2	74
β-strand	341-345	5	75
α-helix	351-361	11
β-strand	365-369	5	75
α-helix	375-377	3
β-strand	381-384	4	76
β-strand	391-394	4	76
α-helix	397-400	4
β-strand	405-409	5	75
α-helix	416-422	7
β-strand	430-431	2	77
β-strand	434	1	78
β-strand	439	1	78
β-strand	442-443	2	77
β-strand	447-452	6	75
α-helix	453-454	2
α-helix	465-468	4
α-helix	473-478	6
β-strand	481-485	5	75
α-helix	491-505	15
α-helix	566-577	12
β-strand	581-582	2	79
α-helix	584-597	14
α-helix	600-602	3
β-strand	604	1	80
β-strand	607-609	3	80
α-helix	615-632	18
β-strand	636-637	2	79
α-helix	639-653	15
β-strand	654-656	3	80

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA replication licensing factor MCM2	2, A	protein	904	Homo sapiens	P49736 (AlphaFold model)
DNA replication licensing factor MCM3	3, B	protein	808	Homo sapiens	P25205 (AlphaFold model)
DNA replication licensing factor MCM4	4, C	protein	863	Homo sapiens	P33991 (AlphaFold model)
DNA replication licensing factor MCM5	5, D	protein	737	Homo sapiens	P33992 (AlphaFold model)
DNA replication licensing factor MCM6	6, E	protein	821	Homo sapiens	Q14566
DNA replication licensing factor MCM7	7, F	protein	722	Homo sapiens	P33993
DNA (44-mer)	O	DNA	44	Saccharomyces cerevisiae
DNA (44-mer)	S	DNA	44	Saccharomyces cerevisiae

Sequence of entity 1 (2, A), FASTA

>9CAQ_1 DNA replication licensing factor MCM2 (chains 2, A)
MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTE
GPLEEEEDGEELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQR
DREAGRGLGRMRRGLLYDSDEEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGH
SVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAR
EHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQL
HLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPGSCPECQSAGP
FEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN
NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFAS
IAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVS
SRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI
HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDIL
CVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVL
KKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARI
HLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV
AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMI
LQQF

Sequence of entity 2 (3, B), FASTA

>9CAQ_2 DNA replication licensing factor MCM3 (chains 3, B)
MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEK
RANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCF
LSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEE
NNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGT
YRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLA
KSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYVLC
TAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRT
AIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFD
LLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQ
DTQIYEKHDNLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQ
DSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEK
EKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQV
HTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPF
SSVEIQAALSKMQDDNQVMVSEGIIFLI

Sequence of entity 3 (4, C), FASTA

>9CAQ_3 DNA replication licensing factor MCM4 (chains 4, C)
MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQ
SPAAQDVLFSSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGS
AQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKE
EENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMA
VNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQ
EAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPED
MPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIH
YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGI
LLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSA
VGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAK
AGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDR
RLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKI
GSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGI
VDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMF
EEALRALADDDFLTVTGKTVRLL

Sequence of entity 4 (5, D), FASTA

>9CAQ_4 DNA replication licensing factor MCM5 (chains 5, D)
SNAMSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRD
ELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSG
EEVLQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRN
TLTNIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVP
HGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVL
GIQVDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLL
FGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTAS
VMRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTT
LNSRCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVI
TLHVSALTQTQAVEGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHE
RDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTL
SGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLR
RGEIQHRMQRKVLYRLK

Sequence of entity 5 (6, E), FASTA

>9CAQ_5 DNA replication licensing factor MCM6 (chains 6, E)
MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNT
LVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNIC
RNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGD
KCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH
LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEY
CRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRL
THYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED

Sequence of entity 6 (7, F), FASTA

>9CAQ_6 DNA replication licensing factor MCM7 (chains 7, F)
SNAMALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAE
DDPELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPG
MVRSPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKM
VVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKM
QEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETY
LEAHRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLL
LVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAA
VLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTT
LNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHI
TYVHQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKD
ATYTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRP
ADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRIT
FV

Sequence of entity 7 (O), FASTA

>9CAQ_7 DNA (44-MER) (chains O)
AAAAAAAAAAAAAAAAAAAAAAATTTTTTTTTTTTTTTTTTTTT

Sequence of entity 8 (S), FASTA

>9CAQ_8 DNA (44-MER) (chains S)
AAAAAAAAAAAAAAAAAAAAATTTTTTTTTTTTTTTTTTTTTTT

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	9
ZN	Zinc ion	Zn	10
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	8
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2

Primary citation

Multiple mechanisms for licensing human replication origins. Yang, R., Hunker, O., Wise, M. et al. Nature (2024) 636:488-498. DOI 10.1038/s41586-024-08237-8 · PubMed

Other PDB entries of the same protein (UniProt P49736 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YA7 1.67 Å, Cdc7-Dbf4 bound to an Mcm2-S40 derived bivalent substrate
7CIZ 1.8 Å, Crystal structure of DNAJC9 HBD helix2 in complex with H3.3-H4 dimer and MCM2 HBD
5BNX 2.31 Å, Crystal structure of Human MCM2 HBD and ASF1b chaperoning a histone H3.3-H4 dimer
5JA4 2.42 Å, Crystal structure of human TONSL and MCM2 HBDs binding to a histone H3-H4 tetramer
7CJ0 2.5 Å, Crystal structure of DNAJC9 HBD in complex with H3.3-H4 dimer and MCM2 HBD
7W1Y 2.59 Å, Human MCM double hexamer bound to natural DNA duplex (polyAT/polyTA)
9E2Z 2.6 Å, Cryo-EM structure of human CMG helicase stalled at G4-containing DNA template
5BNV 2.79 Å, Crystal structure of Human MCM2 HBD chaperoning a histone H3-H4 tetramer
7PLO 2.8 Å, H. sapiens replisome-CUL2/LRR1 complex
8W0F 2.8 Å, Cryo-EM structure of a human MCM2-7 double hexamer on dsDNA
4UUZ 2.9 Å, MCM2-histone complex
5BO0 2.91 Å, Crystal structure of Human MCM2 HBD and ASF1b chaperoning a histone H3.2-H4 dimer

Browse structure collections

About this viewer

MolViewer shows 9CAQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.