9CCE: DYNA_1b7

structure of DYNA_1b7. Determined by X-ray diffraction at 3.15 Å resolution. Released 13 Aug 2025.

Method: X-ray diffraction
Resolution: 3.15 Å
Organisms: synthetic construct, Homo sapiens
Chains: 4
Atoms: 3,355
Mol. weight: 54.7 kDa
Released: 13 Aug 2025

Explore 9CCE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CCE contains 19 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	4-25	22
α-helix	29-51	23
α-helix	55-76	22
α-helix	80-94	15
α-helix	101-122	22
α-helix	129-139	11
α-helix	146-163	18
α-helix	170-179	10
α-helix	184-196	13

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	7-26	20
α-helix	30-51	22
α-helix	55-75	21
α-helix	80-95	16
α-helix	101-122	22
α-helix	128-139	12
α-helix	146-163	18
α-helix	168-179	12
α-helix	186-198	13

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DYNA_1b7	A, B	protein	217	synthetic construct
Dynorphin A(1-17)	C, D	protein	17	Homo sapiens	P01213 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9CCE_1 DYNA_1b7 (chains A, B)
MSGKEEEIEKEFEEKKKIIEENLKEAEEEGEEEAAEKLKEALKKLEEAIKLHREGANPVE
VELEEVTAIILNNLAVLLREGEEELAKELEKAIKLLEEKKDAPEEERLKAIAIAIIRSVL
VLIKWEGGKDEETIEEIEEILENRENLSLEELREAYVRAEIAYLIESGIDPEAAKKVREK
YERGAPLEELLKDIEKIEKEAKKREEEKKGSHHHHHH

Sequence of entity 2 (C, D), FASTA

>9CCE_2 Dynorphin A(1-17) (chains C, D)
YGGFLRRIRPKLKWDNQ

Primary citation

Design of intrinsically disordered region binding proteins. Wu, K., Jiang, H., Hicks, D.R. et al. Science (2025) 389:eadr8063-eadr8063. DOI 10.1126/science.adr8063 · PubMed

Other PDB entries of the same protein (UniProt P01213 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VJU 1.99 Å, Structure of Human Neurolysin in complex with dynorphin A13 peptide
8VJV 2.12 Å, Structure of Human Neurolysin in complex with dynorphin A8(1-8) peptide
9L60 2.9 Å, Gi-bound kappa opioid receptor in complex with dynorphin and positive allosteric…
8F7W 3.19 Å, Gi bound kappa-opioid receptor in complex with dynorphin
7Y1F 3.3 Å, Cryo-EM structure of human k-opioid receptor-Gi complex
9CCF 4.0 Å, Crystal Structure of DA7-2
2N2F Solution NMR structure of Dynorphin 1-13 bound to Kappa Opioid Receptor

Browse structure collections

About this viewer

MolViewer shows 9CCE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.