9CPE: Bcl-2 homologous antagonist/killer

Name: PDB 9CPE: Structural basis of BAK sequestration by MCL-1 and consequences for apoptosis initiation
Published: 2025-06-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Structural basis of BAK sequestration by MCL-1 and consequences for apoptosis initiation. Determined by X-ray diffraction at 1.49 Å resolution. Released 4 Jun 2025.

Method: X-ray diffraction
Resolution: 1.49 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,411
Mol. weight: 18.82 kDa
Released: 4 Jun 2025

Explore 9CPE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CPE contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	21-43	23
α-helix	58-61	4
α-helix	63-64	2
α-helix	70-85	16
α-helix	87-99	13
α-helix	107-118	12
α-helix	125-146	22
α-helix	151-164	14
α-helix	167-173	7
α-helix	177-182	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2 homologous antagonist/killer	A	protein	167	Homo sapiens	Q16611 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9CPE_1 Bcl-2 homologous antagonist/killer (chains A)
PSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPAQPSSTMGQVGRQLA
IIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWRRVVALLGFGYRLA
LHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNG

Primary citation

Structural basis of BAK sequestration by MCL-1 in apoptosis. Srivastava, S., Sekar, G., Ojoawo, A. et al. Mol Cell (2025) 85:1606-1623.e10. DOI 10.1016/j.molcel.2025.03.013 · PubMed

Other PDB entries of the same protein (UniProt Q16611 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VX1 1.22 Å, Bak L100A
8CZF 1.3 Å, Human BAK in complex with the dF2 peptide
8CZH 1.3 Å, Human BAK in complex with the dM2 peptide
2IMS 1.48 Å, The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site
2IMT 1.49 Å, The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site
5FMI 1.49 Å, Human Bak Q77L
7M5A 1.5 Å, Crystal Structure of human BAK in complex with W3W5_BID
5VWY 1.55 Å, Bak core latch dimer in complex with Bim-h3Pc-RT
5VX0 1.6 Å, Bak in complex with Bim-h3Glg
5VWZ 1.62 Å, Bak in complex with Bim-h3Pc
6UXQ 1.7 Å, Crystal structure of BAK core domain BH3-groove-dimer in complex with POPC and C8E4
8IGC 1.7 Å, Crystal structure of Bak bound to Bnip5 BH3

Browse structure collections

About this viewer

MolViewer shows 9CPE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.