9EAJ: Nanobody AT206

Structure of nanobody AT206 in complex with the angiotensin II type I receptor (AT1R). Determined by electron microscopy at 3.2 Å resolution. Released 5 Mar 2025.

Method: Electron microscopy
Resolution: 3.2 Å
Organisms: Camelidae, Homo sapiens, Escherichia coli
Chains: 4
Atoms: 5,246
Mol. weight: 179.17 kDa
Released: 5 Mar 2025

Explore 9EAJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9EAJ contains 22 α-helices and 35 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	31-51	21
α-helix	52-56	5
α-helix	62-89	28
α-helix	98-131	34
α-helix	143-159	17
α-helix	161-166	6
β-strand	167-171	5	1
β-strand	178-183	6	1
α-helix	191-201	11
α-helix	205-243	39
α-helix	248-267	20
α-helix	283-305	23
α-helix	309-322	14
α-helix	323-327	5
α-helix	328-1235	15
α-helix	1237-1267	31
α-helix	1278-1282	5
α-helix	1284-1291	8
α-helix	1294-1305	12

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
α-helix	31	1
β-strand	32	1	2
β-strand	33-37	5	3
β-strand	45-50	6	3
β-strand	56	1	3
β-strand	92	1	4
β-strand	93-94	2	3
β-strand	97	1	2
β-strand	108-109	2	1
β-strand	115	1	4

Chain C: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	5
β-strand	14	1	6
β-strand	21-28	8	5
α-helix	32-34	3
β-strand	36-42	7	7
β-strand	48-55	8	7
β-strand	61-63	3	7
β-strand	71-76	6	5
β-strand	81-86	6	5
β-strand	95-102	8	7
α-helix	108-111	4
β-strand	116	1	7
β-strand	118	1	5
β-strand	121-123	3	7
β-strand	124	1	6

Chain D: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	8
β-strand	11-14	4	9
β-strand	20-26	7	8
β-strand	34-39	6	9
β-strand	46-49	4	9
β-strand	55	1	9
α-helix	56	1
β-strand	63-68	6	8
β-strand	71-76	6	8
β-strand	86-91	6	9
α-helix	95-97	3
β-strand	99-100	2	9
β-strand	104-108	5	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nanobody AT206,Type-1 angiotensin II receptor,Soluble cytochrome b562	A, B	protein	583	Camelidae, Homo sapiens, Escherichia coli	P30556 (AlphaFold model)
BAG2 Anti-BRIL Fab Heavy Chain	C	protein	231	synthetic construct
BAG2 Anti-BRIL Fab Light Chain	D	protein	215	synthetic construct

Sequence of entity 1 (A, B), FASTA

>9EAJ_1 Nanobody AT206,Type-1 angiotensin II receptor,Soluble cytochrome b562 (chains A, B)
QVQLQESGGGLVQAGGSLRLSCAASGSISYYRMGWYRQAPGKEREFVAGIGVGTTTNYAD
SVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAYNYFPRSIVYYYVYWGQGTQVTVS
SGGSGEDQVDPRLIDGKILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIF
GNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIA
SASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAI
IHRNVFFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKK
AYDLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMK
DFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLDKLNDD
IFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCL
NPLFYGFLGKKFKRYFLQLLKYGGSSLEVLFQGPTETSQVAPA

Sequence of entity 2 (C), FASTA

>9EAJ_2 BAG2 Anti-BRIL Fab Heavy Chain (chains C)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVVDFSLHWVRQAPGKGLEWVAYISSSSGS
TSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARWGYWPGEPWWKAFDYWGQG
TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF
PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD

Sequence of entity 3 (D), FASTA

>9EAJ_3 BAG2 Anti-BRIL Fab Light Chain (chains D)
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQYLYYSLVTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Epitope-directed selection of GPCR nanobody ligands with evolvable function. Skiba, M.A., Canavan, C., Nemeth, G.R. et al. Proc Natl Acad Sci U S A (2025) 122:e2423931122-e2423931122. DOI 10.1073/pnas.2423931122 · PubMed

Other PDB entries of the same protein (UniProt P30556 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OS2 2.7 Å, Structure of synthetic nanobody-stabilized angiotensin II type 1 receptor bound to TRV026
6OS1 2.79 Å, Structure of synthetic nanobody-stabilized angiotensin II type 1 receptor bound to TRV023
4ZUD 2.8 Å, Crystal Structure of Human Angiotensin Receptor in Complex with Inverse Agonist…
4YAY 2.9 Å, XFEL structure of human Angiotensin Receptor
6OS0 2.9 Å, Structure of synthetic nanobody-stabilized angiotensin II type 1 receptor bound to…
6DO1 2.9 Å, Structure of nanobody-stabilized angiotensin II type 1 receptor bound to S1I8
8TH3 3.0 Å, Structure of AT118-H Nanobody Antagonist in Complex with the Angiotensin II Type I…
9Q0F 3.02 Å, Structure of angiotensin II type 1 receptor bound to a b-arrestin biased allosteric…
9EAH 3.1 Å, Structure of nanobody AT209 in complex with the olmesartan-bound angiotensin II type I…
9EAI 3.1 Å, Structure of nanobody AT206 in complex with the losartan-bound angiotensin II type I…
9ZXD 3.2 Å, Structure of AT118-R nanobody in complex with the angiotensin II type I receptor bound…
8TH4 3.3 Å, Structure of AT118-L Nanobody Antagonist in Complex with the Angiotensin II Type I…

Browse structure collections

About this viewer

MolViewer shows 9EAJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.