9Q0F: Angiotensin II type 1 receptor

Structure of angiotensin II type 1 receptor bound to a b-arrestin biased allosteric modulator stabilized by a synthetic nanobody. Determined by electron microscopy at 3.02 Å resolution. Released 26 Aug 2026.

Method: Electron microscopy
Resolution: 3.02 Å
Organisms: Homo sapiens, synthetic construct
Chains: 3
Atoms: 3,450
Mol. weight: 59.16 kDa
Ligands: A1CNF, CLR
Released: 26 Aug 2026

Explore 9Q0F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9Q0F contains 14 α-helices and 17 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	12-14	3	1
α-helix	25-57	33
α-helix	62-78	17
α-helix	81-89	9
α-helix	98-131	34
α-helix	142-159	18
α-helix	161-166	6
β-strand	168-172	5	1
β-strand	177-181	5	1
β-strand	184	1	2
α-helix	193-200	8
α-helix	201-205	5
α-helix	206-228	23
α-helix	238-268	31
α-helix	274-296	23
α-helix	298-303	6
α-helix	308-316	9

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2	1	2

Chain D: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	3
β-strand	10-13	4	4
β-strand	17-25	9	3
β-strand	31-39	9	4
β-strand	46-52	7	4
β-strand	57-59	3	4
β-strand	64	1	3
β-strand	67-72	6	3
β-strand	77-83	7	3
α-helix	87-89	3
β-strand	91-99	9	4
β-strand	114-116	3	4
β-strand	120-125	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Type-1 angiotensin II receptor	A	protein	366	Homo sapiens	P30556 (AlphaFold model)
TRV023	B	protein	8	synthetic construct
Nanobody NB.AT110i1	D	protein	134	synthetic construct

Sequence of entity 1 (A), FASTA

>9Q0F_1 Type-1 angiotensin II receptor (chains A)
DYKDDDDKILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVI
YFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLY
ASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIE
NTNITVCAFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKP
RNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYF
NNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPA
PCFEVE

Sequence of entity 2 (B), FASTA

>9Q0F_2 TRV023 (chains B)
GRVYKHPA

Sequence of entity 3 (D), FASTA

>9Q0F_3 Nanobody NB.AT110i1 (chains D)
QVQLQESGGGLVQAGGSLRLSCAASGNIFDVDIMGWYRQAPGKERELVASITDGGSTDYA
DSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAVAYPDIPTYFDYDSDNFYWGQGT
QVTVSSLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
A1CNF	(7P)-N-[(1R)-3-amino-1-(6-methoxypyridin-3-yl)-3-oxopropyl]-7-(3-chlorophenyl)-…	C35 H33 Cl F3 N7 O3	1
CLR	Cholesterol	C27 H46 O	2

Primary citation

Conformational Basis of Functionally Selective Allosteric Modulation of the Angiotensin II type 1 Receptor by Small Molecules. Liu, S., Xiao, P., Elgeti, M. et al. To be published.

Other PDB entries of the same protein (UniProt P30556 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OS2 2.7 Å, Structure of synthetic nanobody-stabilized angiotensin II type 1 receptor bound to TRV026
6OS1 2.79 Å, Structure of synthetic nanobody-stabilized angiotensin II type 1 receptor bound to TRV023
4ZUD 2.8 Å, Crystal Structure of Human Angiotensin Receptor in Complex with Inverse Agonist…
4YAY 2.9 Å, XFEL structure of human Angiotensin Receptor
6OS0 2.9 Å, Structure of synthetic nanobody-stabilized angiotensin II type 1 receptor bound to…
6DO1 2.9 Å, Structure of nanobody-stabilized angiotensin II type 1 receptor bound to S1I8
8TH3 3.0 Å, Structure of AT118-H Nanobody Antagonist in Complex with the Angiotensin II Type I…
9EAH 3.1 Å, Structure of nanobody AT209 in complex with the olmesartan-bound angiotensin II type I…
9EAI 3.1 Å, Structure of nanobody AT206 in complex with the losartan-bound angiotensin II type I…
9EAJ 3.2 Å, Structure of nanobody AT206 in complex with the angiotensin II type I receptor (AT1R)
9ZXD 3.2 Å, Structure of AT118-R nanobody in complex with the angiotensin II type I receptor bound…
8TH4 3.3 Å, Structure of AT118-L Nanobody Antagonist in Complex with the Angiotensin II Type I…

Browse structure collections

About this viewer

MolViewer shows 9Q0F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.