9ECM: Human integrin alphaX transmembrane domain

Structure of the human integrin alphaX transmembrane domain. Determined by solution NMR. Released 24 Sept 2025.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 329
Mol. weight: 4.64 kDa
Released: 24 Sept 2025

Explore 9ECM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ECM contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1081-1083	3
α-helix	1087-1110	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-X	A	protein	42	Homo sapiens	P20702 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9ECM_1 Integrin alpha-X (chains A)
GEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYK

Primary citation

Functional unfolding of the integrin alpha X transmembrane helix. Vu, H.N., Lee, M., Situ, A.J. et al. Proc Natl Acad Sci U S A (2025) 122:e2507966122-e2507966122. DOI 10.1073/pnas.2507966122 · PubMed

Other PDB entries of the same protein (UniProt P20702 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1N3Y 1.65 Å, Crystal structure of the alpha-X beta2 integrin I domain
4NEH 2.75 Å, An internal ligand-bound, metastable state of a leukocyte integrin, aXb2
4NEN 2.9 Å, An internal ligand-bound, metastable state of a leukocyte integrin, aXb2
5ES4 3.3 Å, Re-refinement of integrin ALPHAXBETA2 ectodomain in the closed/bent conformation
3K6S 3.5 Å, Structure of integrin alphaXbeta2 ectodomain
3K72 3.7 Å, Structure of integrin alphaX beta2
3K71 3.95 Å, Structure of integrin alphaX beta2 ectodomain
2LUV Structure and Binding Interface of the Cytosolic Tails of aXb2 Integrin

Browse structure collections

About this viewer

MolViewer shows 9ECM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.