9EH1: DNA-directed RNA polymerase subunit
RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-nucleosome, 20 bp upstream. Determined by electron microscopy at 3.1 Å resolution. Released 18 Dec 2024.
- Method
- Electron microscopy
- Resolution
- 3.1 Å
- Organisms
- Sus scrofa, Homo sapiens, synthetic construct
- Chains
- 35
- Atoms
- 72,243
- Mol. weight
- 1180.54 kDa
- Ligands
- MG, ZN
- Released
- 18 Dec 2024
Explore 9EH1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9EH1 contains 386 α-helices and 426 β-strands across 32 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain a: 5 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 36 | 1 | 32 |
| β-strand | 37 | 1 | 33 |
| α-helix | 41-42 | 2 | |
| α-helix | 45-56 | 12 | |
| α-helix | 64-75 | 12 | |
| β-strand | 83-84 | 2 | 34 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 35 |
| α-helix | 121-131 | 11 | |
Chain A: 78 helices, 71 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 15 | 1 | 1 |
| β-strand | 21-22 | 2 | 2 |
| α-helix | 28-34 | 7 | |
| β-strand | 43 | 1 | 3 |
| β-strand | 49 | 1 | 4 |
| β-strand | 51 | 1 | 4 |
| β-strand | 56 | 1 | 3 |
| α-helix | 83-85 | 3 | |
| β-strand | 88 | 1 | 5 |
| β-strand | 94 | 1 | 6 |
| α-helix | 100-109 | 10 | |
| α-helix | 111 | 1 | |
| α-helix | 120-122 | 3 | |
| α-helix | 124-132 | 9 | |
| α-helix | 137-147 | 11 | |
| β-strand | 192-193 | 2 | 7 |
| β-strand | 198-199 | 2 | 7 |
| β-strand | 215-216 | 2 | 7 |
| α-helix | 218-227 | 10 | |
| α-helix | 230-236 | 7 | |
| β-strand | 250 | 1 | 6 |
| β-strand | 253 | 1 | 5 |
| α-helix | 254-256 | 3 | |
| α-helix | 258-260 | 3 | |
| α-helix | 262-263 | 2 | |
| β-strand | 264 | 1 | 8 |
| α-helix | 265 | 1 | |
| β-strand | 272 | 1 | 8 |
| α-helix | 273-274 | 2 | |
| α-helix | 275-292 | 18 | |
| α-helix | 293-297 | 5 | |
| α-helix | 302-318 | 17 | |
| α-helix | 326-328 | 3 | |
| β-strand | 329 | 1 | 9 |
| β-strand | 335 | 1 | 9 |
| α-helix | 339-343 | 5 | |
| α-helix | 350-354 | 5 | |
| β-strand | 357-358 | 2 | 10 |
| β-strand | 362-365 | 4 | 11 |
| β-strand | 367-369 | 3 | 12 |
| β-strand | 377-380 | 4 | 11 |
| α-helix | 382-387 | 6 | |
| β-strand | 389-393 | 5 | 13 |
| α-helix | 399-408 | 10 | |
| β-strand | 416-420 | 5 | 13 |
| β-strand | 426-428 | 3 | 13 |
| α-helix | 429-431 | 3 | |
| α-helix | 435-438 | 4 | |
| β-strand | 445-449 | 5 | 13 |
| α-helix | 450 | 1 | |
| β-strand | 455-460 | 6 | 11 |
| β-strand | 469-476 | 8 | 11 |
| β-strand | 482-484 | 3 | 12 |
| α-helix | 486-488 | 3 | |
| α-helix | 489-492 | 4 | |
| β-strand | 501-504 | 4 | 11 |
| α-helix | 509-518 | 10 | |
| α-helix | 522-524 | 3 | |
| β-strand | 526-527 | 2 | 14 |
| β-strand | 532-533 | 2 | 14 |
| α-helix | 540-548 | 9 | |
| β-strand | 554-556 | 3 | 15 |
| α-helix | 557-565 | 9 | |
| α-helix | 574-577 | 4 | |
| β-strand | 579-581 | 3 | 15 |
| β-strand | 585-587 | 3 | 15 |
| α-helix | 588-595 | 8 | |
| β-strand | 602-604 | 3 | 16 |
| β-strand | 628-631 | 4 | 16 |
| β-strand | 634-637 | 4 | 16 |
| α-helix | 642-645 | 4 | |
| α-helix | 652-659 | 8 | |
| α-helix | 662-683 | 22 | |
| β-strand | 686 | 1 | 17 |
| α-helix | 689-691 | 3 | |
| α-helix | 698-721 | 24 | |
| α-helix | 726-728 | 3 | |
| α-helix | 733-758 | 26 | |
| α-helix | 765-772 | 8 | |
| α-helix | 778-784 | 7 | |
| β-strand | 789 | 1 | 18 |
| β-strand | 793 | 1 | 19 |
| β-strand | 796 | 1 | 19 |
| β-strand | 802 | 1 | 20 |
| β-strand | 805 | 1 | 20 |
| α-helix | 811 | 1 | |
| α-helix | 817-820 | 4 | |
| β-strand | 823 | 1 | 18 |
| α-helix | 833-867 | 35 | |
| β-strand | 872-874 | 3 | 21 |
| β-strand | 878-880 | 3 | 21 |
| β-strand | 886-888 | 3 | 21 |
| α-helix | 891-893 | 3 | |
| β-strand | 896 | 1 | 22 |
| β-strand | 902-905 | 4 | 23 |
| α-helix | 913-920 | 8 | |
| α-helix | 927-933 | 7 | |
| β-strand | 934 | 1 | 24 |
| α-helix | 936-944 | 9 | |
| α-helix | 946-969 | 24 | |
| β-strand | 976-979 | 4 | 23 |
| α-helix | 983-994 | 12 | |
| α-helix | 1001 | 1 | |
| β-strand | 1002 | 1 | 24 |
| α-helix | 1006-1019 | 14 | |
| α-helix | 1028-1037 | 10 | |
| α-helix | 1040-1048 | 9 | |
| α-helix | 1051-1053 | 3 | |
| α-helix | 1054-1058 | 5 | |
| α-helix | 1062-1078 | 17 | |
| β-strand | 1080 | 1 | 22 |
| α-helix | 1081-1082 | 2 | |
| α-helix | 1087-1101 | 15 | |
| α-helix | 1121-1128 | 8 | |
| β-strand | 1140-1142 | 3 | 25 |
| β-strand | 1143 | 1 | 26 |
| α-helix | 1146-1148 | 3 | |
| α-helix | 1152-1161 | 10 | |
| β-strand | 1164 | 1 | 27 |
| α-helix | 1166-1169 | 4 | |
| β-strand | 1170-1176 | 7 | 28 |
| α-helix | 1191-1194 | 4 | |
| β-strand | 1211-1216 | 6 | 28 |
| α-helix | 1218-1224 | 7 | |
| α-helix | 1228-1238 | 11 | |
| β-strand | 1243 | 1 | 29 |
| β-strand | 1255 | 1 | 28 |
| β-strand | 1259 | 1 | 28 |
| β-strand | 1261 | 1 | 29 |
| α-helix | 1281-1294 | 14 | |
| β-strand | 1299 | 1 | 27 |
| β-strand | 1308-1309 | 2 | 25 |
| β-strand | 1319 | 1 | 30 |
| β-strand | 1331 | 1 | 30 |
| β-strand | 1335-1337 | 3 | 25 |
| α-helix | 1344-1348 | 5 | |
| β-strand | 1352 | 1 | 26 |
| β-strand | 1358 | 1 | 25 |
| α-helix | 1362-1368 | 7 | |
| α-helix | 1371-1387 | 17 | |
| α-helix | 1395-1405 | 11 | |
| α-helix | 1416-1419 | 4 | |
| α-helix | 1426-1432 | 7 | |
| α-helix | 1435-1445 | 11 | |
| β-strand | 1448-1449 | 2 | 2 |
| α-helix | 1454-1459 | 6 | |
| β-strand | 1471-1475 | 5 | 31 |
| α-helix | 1479-1481 | 3 | |
| α-helix | 1534-1537 | 4 | |
Chain b: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-28 | 4 | |
| α-helix | 31-41 | 11 | |
| β-strand | 45-46 | 2 | 35 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 34 |
| α-helix | 83-93 | 11 | |
| β-strand | 96-98 | 3 | 58 |
Chain B: 48 helices, 76 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 22-36 | 15 | |
| α-helix | 41-49 | 9 | |
| α-helix | 50-54 | 5 | |
| α-helix | 55-61 | 7 | |
| β-strand | 83-84 | 2 | 36 |
| β-strand | 87-93 | 7 | 37 |
| α-helix | 110-115 | 6 | |
| β-strand | 121-129 | 9 | 37 |
| β-strand | 131-134 | 4 | 36 |
| β-strand | 138-141 | 4 | 36 |
| β-strand | 144-153 | 10 | 37 |
| α-helix | 168-173 | 6 | |
| β-strand | 185-187 | 3 | 38 |
| β-strand | 190-194 | 5 | 38 |
| β-strand | 196-200 | 5 | 39 |
| α-helix | 201 | 1 | |
| β-strand | 205 | 1 | 40 |
| β-strand | 208 | 1 | 40 |
| β-strand | 215-223 | 9 | 40 |
| α-helix | 231-232 | 2 | |
| β-strand | 233-240 | 8 | 40 |
| β-strand | 256 | 1 | 40 |
| β-strand | 258 | 1 | 41 |
| β-strand | 259 | 1 | 40 |
| β-strand | 263 | 1 | 42 |
| β-strand | 267 | 1 | 41 |
| α-helix | 269-275 | 7 | |
| α-helix | 281-288 | 8 | |
| α-helix | 295-307 | 13 | |
| α-helix | 314-323 | 10 | |
| β-strand | 325 | 1 | 42 |
| α-helix | 332-345 | 14 | |
| α-helix | 358-377 | 20 | |
| α-helix | 381-384 | 4 | |
| α-helix | 388-390 | 3 | |
| β-strand | 391-394 | 4 | 39 |
| α-helix | 396-424 | 29 | |
| α-helix | 427-429 | 3 | |
| α-helix | 431-434 | 4 | |
| α-helix | 440-450 | 11 | |
| β-strand | 453 | 1 | 43 |
| α-helix | 459-461 | 3 | |
| β-strand | 463 | 1 | 43 |
| β-strand | 467-469 | 3 | 38 |
| α-helix | 475-482 | 8 | |
| β-strand | 484-486 | 3 | 39 |
| α-helix | 490 | 1 | |
| β-strand | 509 | 1 | 44 |
| β-strand | 523-525 | 3 | 39 |
| β-strand | 526 | 1 | 44 |
| β-strand | 531-532 | 2 | 45 |
| α-helix | 539-547 | 9 | |
| β-strand | 551 | 1 | 46 |
| α-helix | 558-560 | 3 | |
| β-strand | 565-569 | 5 | 46 |
| β-strand | 572-577 | 6 | 46 |
| α-helix | 580-593 | 14 | |
| β-strand | 602-606 | 5 | 46 |
| β-strand | 611-615 | 5 | 46 |
| β-strand | 621-627 | 7 | 45 |
| β-strand | 628 | 1 | 47 |
| β-strand | 633 | 1 | 47 |
| α-helix | 637-644 | 8 | |
| α-helix | 653-659 | 7 | |
| β-strand | 662-666 | 5 | 45 |
| α-helix | 667-670 | 4 | |
| β-strand | 695-696 | 2 | 45 |
| α-helix | 700-703 | 4 | |
| α-helix | 706-709 | 4 | |
| α-helix | 714-716 | 3 | |
| α-helix | 719-729 | 11 | |
| β-strand | 732 | 1 | 48 |
| β-strand | 749-751 | 3 | 49 |
| β-strand | 759-760 | 2 | 50 |
| α-helix | 764-767 | 4 | |
| α-helix | 769-771 | 3 | |
| β-strand | 776-782 | 7 | 51 |
| β-strand | 783 | 1 | 17 |
| β-strand | 793-797 | 5 | 51 |
| α-helix | 798-802 | 5 | |
| β-strand | 808-817 | 10 | 49 |
| β-strand | 826-829 | 4 | 52 |
| β-strand | 837-839 | 3 | 52 |
| β-strand | 853 | 1 | 53 |
| α-helix | 854-855 | 2 | |
| β-strand | 859 | 1 | 49 |
| β-strand | 865 | 1 | 54 |
| β-strand | 867 | 1 | 53 |
| β-strand | 869-872 | 4 | 52 |
| β-strand | 889-890 | 2 | 52 |
| β-strand | 895 | 1 | 54 |
| α-helix | 896-897 | 2 | |
| β-strand | 903-911 | 9 | 49 |
| β-strand | 917-927 | 11 | 49 |
| β-strand | 934-937 | 4 | 51 |
| β-strand | 943-949 | 7 | 51 |
| β-strand | 956 | 1 | 55 |
| β-strand | 965-966 | 2 | 51 |
| α-helix | 971-975 | 5 | |
| α-helix | 978-993 | 16 | |
| β-strand | 997-998 | 2 | 50 |
| α-helix | 1008-1015 | 8 | |
| α-helix | 1016-1018 | 3 | |
| β-strand | 1025-1026 | 2 | 51 |
| β-strand | 1029 | 1 | 55 |
| α-helix | 1035 | 1 | |
| β-strand | 1036 | 1 | 55 |
| α-helix | 1037 | 1 | |
| β-strand | 1041-1050 | 10 | 51 |
| β-strand | 1051 | 1 | 48 |
| β-strand | 1060-1061 | 2 | 11 |
| β-strand | 1067 | 1 | 56 |
| β-strand | 1074 | 1 | 56 |
| β-strand | 1085-1086 | 2 | 10 |
| α-helix | 1088-1097 | 10 | |
| α-helix | 1100-1104 | 5 | |
| α-helix | 1105-1109 | 5 | |
| β-strand | 1115-1119 | 5 | 1 |
| β-strand | 1125 | 1 | 1 |
| β-strand | 1127 | 1 | 57 |
| β-strand | 1136 | 1 | 57 |
| β-strand | 1146-1150 | 5 | 1 |
| α-helix | 1153-1164 | 12 | |
| β-strand | 1170 | 1 | 2 |
Chain c: 5 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-21 | 5 | |
| α-helix | 27-35 | 9 | |
| β-strand | 42-43 | 2 | 65 |
| α-helix | 47-72 | 26 | |
| β-strand | 77-78 | 2 | 66 |
| α-helix | 80-89 | 10 | |
| α-helix | 91-96 | 6 | |
| β-strand | 101-102 | 2 | 67 |
Chain C: 11 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-14 | 7 | 59 |
| β-strand | 18 | 1 | 60 |
| β-strand | 19-24 | 6 | 59 |
| α-helix | 28-39 | 12 | |
| β-strand | 44-55 | 12 | 61 |
| α-helix | 61-69 | 9 | |
| β-strand | 73 | 1 | 62 |
| α-helix | 85-87 | 3 | |
| α-helix | 95-97 | 3 | |
| β-strand | 99-106 | 8 | 61 |
| α-helix | 112 | 1 | |
| β-strand | 113-116 | 4 | 63 |
| α-helix | 117-119 | 3 | |
| β-strand | 121-122 | 2 | 61 |
| β-strand | 129 | 1 | 62 |
| β-strand | 149-153 | 5 | 63 |
| β-strand | 158-168 | 11 | 61 |
| α-helix | 174-176 | 3 | |
| β-strand | 179 | 1 | 64 |
| β-strand | 185-186 | 2 | 59 |
| α-helix | 200-202 | 3 | |
| α-helix | 204-206 | 3 | |
| α-helix | 218-220 | 3 | |
| β-strand | 229-231 | 3 | 59 |
| β-strand | 234 | 1 | 60 |
| β-strand | 235 | 1 | 64 |
| α-helix | 241-269 | 29 | |
Chain d: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-48 | 11 | |
| β-strand | 53-54 | 2 | 66 |
| α-helix | 56-83 | 28 | |
| β-strand | 88-89 | 2 | 65 |
| α-helix | 91-101 | 11 | |
| α-helix | 105-122 | 18 | |
Chain D: 10 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 16 | 1 | 68 |
| α-helix | 17-19 | 3 | |
| α-helix | 24-27 | 4 | |
| β-strand | 31 | 1 | 31 |
| α-helix | 34-49 | 16 | |
| α-helix | 55-58 | 4 | |
| α-helix | 59-69 | 11 | |
| α-helix | 77-88 | 12 | |
| α-helix | 95-103 | 9 | |
| α-helix | 108-114 | 7 | |
| α-helix | 116-118 | 3 | |
| α-helix | 124-137 | 14 | |
24 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA-directed RNA polymerase subunit | A | protein | 1544 | Sus scrofa | A0A8D1DPV6 |
| DNA-directed RNA polymerase subunit beta | B | protein | 1159 | Sus scrofa | I3LGP4 (AlphaFold model) |
| DNA-directed RNA polymerase II subunit RPB3 | C | protein | 269 | Sus scrofa | I3LCH3 (AlphaFold model) |
| RNA polymerase Rpb4/RPC9 core domain-containing protein | D | protein | 126 | Sus scrofa | A0A287ADR4 (AlphaFold model) |
| DNA-directed RNA polymerase II subunit E | E | protein | 209 | Sus scrofa | I3LSI7 |
| DNA-directed RNA polymerases I, II, and III subunit RPABC2 | F | protein | 78 | Sus scrofa | A0A4X1VEK9 |
| DNA-directed RNA polymerase subunit | G | protein | 171 | Sus scrofa | A0A4X1VKG7 |
| DNA-directed RNA polymerases I, II, and III subunit RPABC3 | H | protein | 149 | Sus scrofa | I3LCB2 |
| DNA-directed RNA polymerase II subunit RPB9 | I | protein | 116 | Sus scrofa | P60899 |
| DNA-directed RNA polymerase I, II, and III subunit RPABC5 | J | protein | 66 | Sus scrofa | A0A8W4F9W9 |
| DNA-directed RNA polymerase II subunit RPB11-a | K | protein | 115 | Sus scrofa | F1RKE4 |
| RNA polymerase II subunit K | L | protein | 47 | Sus scrofa | A0A4X1TRS6 |
19 more molecules are not listed.
Sequence of entity 1 (A), FASTA
>9EH1_1 DNA-directed RNA polymerase subunit (chains A)
DSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTG
RCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDI
LAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQP
RIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMI
VTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKL
LQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITP
DPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDL
RFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVT
TPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFT
KRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTH
PDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFY
SNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTP
GNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVG
QQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLID
TAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATL
KPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVI
FPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPL
SRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGA
LAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSAR
DAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISP
WLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKM
QEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFK
ALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFD
GSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESD
PMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSP
MGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASD
Sequence of entity 2 (B), FASTA
>9EH1_2 DNA-directed RNA polymerase subunit beta (chains B)
EITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHAS
GEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKE
GEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLI
AQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQR
IVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQN
VALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLA
ALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAI
KTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKL
AKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEE
ISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIY
TDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVML
AMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGV
YITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVI
MNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIA
PGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEG
YKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSR
MTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGR
KITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQI
AHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYAC
KLLFQELMSMSIAPRMMSV
Sequence of entity 3 (C), FASTA
>9EH1_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
PYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHD
EFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLI
SNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAG
VAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRP
ETIVLSALSGLKKKLSDLQTQLSHEIQSD
Sequence of entity 4 (D), FASTA
>9EH1_4 RNA polymerase Rpb4/RPC9 core domain-containing protein (chains D)
EEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSR
FKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDD
IQTKRS
Sequence of entity 5 (E), FASTA
>9EH1_5 DNA-directed RNA polymerase II subunit E (chains E)
DDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVL
VAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDM
APKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVAR
YFGIKRGQVVKIIRPSETAGRYITYRLVQ
Sequence of entity 6 (F), FASTA
>9EH1_6 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
KRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRY
LPDGSYEDWGVDELIISD
Sequence of entity 7 (G), FASTA
>9EH1_7 DNA-directed RNA polymerase subunit (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLV
Sequence of entity 8 (H), FASTA
>9EH1_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
AGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIA
STLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGL
LMRLQGDANNLHGFEVDSRVYLLMKKLAF
Sequence of entity 9 (I), FASTA
>9EH1_9 DNA-directed RNA polymerase II subunit RPB9 (chains I)
GFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQII
ADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE
Sequence of entity 10 (J), FASTA
>9EH1_10 DNA-directed RNA polymerase I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLE
Sequence of entity 11 (K), FASTA
>9EH1_11 DNA-directed RNA polymerase II subunit RPB11-a (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEG
Sequence of entity 12 (L), FASTA
>9EH1_12 RNA polymerase II subunit K (chains L)
QQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 1 |
| ZN | Zinc ion | Zn | 9 |
Primary citation
Structural basis of H3K36 trimethylation by SETD2 during chromatin transcription. Markert, J.W., Soffers, J.H., Farnung, L. Science (2025) 387:528-533. DOI 10.1126/science.adn6319 · PubMed
Other PDB entries of the same protein (UniProt A0A8D1DPV6), best resolution first:
- 9HVQ 2.0 Å, Structure of the transcribing Pol II-DSIF-PAF-SPT6-RECQL5 complex
- 7NVU 2.5 Å, RNA polymerase II core pre-initiation complex with open promoter DNA
- 8QEP 2.5 Å, RNA polymerase II bound to Alu RNA right arm
- 8B3D 2.6 Å, Structure of the Pol II-TCR-ELOF1 complex.
- 7OOB 2.7 Å, Pol II-CSB-CSA-DDB1-UVSSA-ADPBeF3 (Structure2)
- 8UHG 2.7 Å, Structure of paused transcription complex Pol II-DSIF-NELF - poised post-translocated
- 8UI0 2.7 Å, Structure of poised transcription complex Pol II-DSIF-NELF - pre-translocated
- 8WAV 2.72 Å, De novo transcribing complex 12 (TC12), the early elongation complex with Pol II…
- 8WAX 2.75 Å, De novo transcribing complex 14 (TC14), the early elongation complex with Pol II…
- 8WAZ 2.76 Å, De novo transcribing complex 16 (TC16), the early elongation complex with Pol II…
- 7F4G 2.78 Å, Structure of RPAP2-bound RNA polymerase II
- 8WAU 2.78 Å, De novo transcribing complex 11 (TC11), the early elongation complex with Pol II…
Browse structure collections
About this viewer
MolViewer shows 9EH1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.