9EHS: Human adenosine A3 receptor complex

Structure of a human adenosine A3 receptor complex bound to the covalent antagonist LUF7602. Determined by electron microscopy at 3.2 Å resolution. Released 20 Aug 2025.

Method: Electron microscopy
Resolution: 3.2 Å
Organisms: synthetic construct, Homo sapiens
Chains: 4
Atoms: 7,201
Mol. weight: 116.75 kDa
Ligands: A1BII
Released: 20 Aug 2025

Explore 9EHS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9EHS contains 33 α-helices and 57 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
β-strand	14-15	2	2
β-strand	20-27	8	1
β-strand	35-42	8	3
β-strand	48-55	8	3
β-strand	60-63	4	3
β-strand	71-76	6	1
β-strand	81-87	7	1
α-helix	91-93	3
β-strand	95-103	9	3
α-helix	108-111	4
β-strand	113-117	5	3
β-strand	121-123	3	3
β-strand	124-125	2	2
α-helix	132-134	3
β-strand	135-138	4	4
α-helix	139-141	3
β-strand	149-159	11	4
β-strand	165-168	4	5
β-strand	173	1	5
β-strand	177-179	3	4
α-helix	180-182	3
β-strand	183-184	2	4
β-strand	190-199	10	4
α-helix	200-202	3
β-strand	209-214	6	5
β-strand	219-224	6	5
α-helix	225	1

Chain K: 0 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	6
β-strand	5-7	3	7
β-strand	10-12	3	8
β-strand	17-23	7	7
β-strand	33-39	7	8
β-strand	45-51	7	8
β-strand	58-60	3	8
β-strand	68-73	6	7
β-strand	78-84	7	7
β-strand	92-99	8	8
β-strand	108-111	4	8
β-strand	112	1	6
β-strand	115-119	5	8

Chain L: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	9
β-strand	11-14	4	10
β-strand	20-26	7	9
β-strand	34-39	6	10
β-strand	46-50	5	10
β-strand	54-55	2	10
α-helix	56	1
β-strand	63-68	6	9
β-strand	71-76	6	9
α-helix	81-83	3
β-strand	86-91	6	10
β-strand	99-100	2	10
β-strand	104-108	5	10
β-strand	113	1	11
β-strand	116-120	5	12
α-helix	121-123	3
α-helix	124-127	4
β-strand	131-141	11	12
β-strand	142	1	11
β-strand	146-152	7	13
β-strand	156	1	13
β-strand	161-165	5	12
α-helix	166-169	4
β-strand	175-184	10	12
α-helix	185-188	4
β-strand	193-200	8	13
β-strand	207-212	6	13

Chain R: 20 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	13-39	27
α-helix	46-74	29
β-strand	77	1	14
α-helix	80-113	34
α-helix	117-121	5
α-helix	124-142	19
α-helix	145-149	5
α-helix	151-154	4
α-helix	157-159	3
β-strand	165	1	14
α-helix	168-171	4
α-helix	174-175	2
α-helix	176-187	12
α-helix	188-225	38
α-helix	232-249	18
α-helix	268-288	21
α-helix	292-299	8
α-helix	302-305	4
α-helix	306-310	5
α-helix	311-353	43
α-helix	360-384	25
α-helix	386-389	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BAG2 Anti-BRIL Fab Heavy Chain	H	protein	231	synthetic construct
elbow nanobody	K	protein	136	synthetic construct
BAG2 Anti-BRIL Fab Light Chain	L	protein	215	synthetic construct
Adenosine receptor A3,adenosine A3 receptor fused to BRIL	R	protein	469	Homo sapiens	P0DMS8 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>9EHS_1 BAG2 Anti-BRIL Fab Heavy Chain (chains H)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVVDFSLHWVRQAPGKGLEWVAYISSSSGS
TSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARWGYWPGEPWWKAFDYWGQG
TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF
PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD

Sequence of entity 2 (K), FASTA

>9EHS_2 elbow nanobody (chains K)
HHHHHHGENLYFQGSQVQLQESGGGLVQPGGSLRLSCAASGRTISRYAMSWFRQAPGKER
EFVAVARRSGDGAFYADSVQGRFTVSRDDAKNTVYLQMNSLKPEDTAVYYCAIDSDTFYS
GSYDYWGQGTQVTVSS

Sequence of entity 3 (L), FASTA

>9EHS_3 BAG2 Anti-BRIL Fab Light Chain (chains L)
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQYLYYSLVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (R), FASTA

>9EHS_4 Adenosine receptor A3,adenosine A3 receptor fused to BRIL (chains R)
DYKDDDDAMGANFTPVNGSSGNQSVRLVTSSSLEVLFQGPSTALSLANVTYITMEIFIGL
CAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIAVGVLVMPLAIVVSLGITIHFYSCL
FMTCLLLIFTHARIMSLLAIAVDRYLRVKLTVRYKRVTTHRRIWLALGLCWLVSFLVGLT
PMFGWNMKLTSEYHRAVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYII
RNKLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSP
EMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLQRE
FKTAKSLFLVLFLFALSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYK
IKKFKETYLLILKACVVCHPLEVLFQGPSDSLDTSIEKNSEHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
A1BII	LUF7602	C23 H24 F N5 O6 S	1

Primary citation

Molecular basis of ligand binding and receptor activation at the human A 3 adenosine receptor. Zhang, L., Mobbs, J.I., Bennetts, F.M. et al. Nat Commun (2025) 16:7674-7674. DOI 10.1038/s41467-025-62872-x · PubMed

Other PDB entries of the same protein (UniProt P0DMS8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8X17 3.19 Å, Cryo-EM structure of adenosine receptor A3AR bound to CF102
8X16 3.29 Å, Cryo-EM structure of adenosine receptor A3AR bound to CF101
9EBH 3.6 Å, Human adenosine A3 receptor Gi1 complex bound to adenosine
9EBI 3.6 Å, Human adenosine A3 receptor Gi complex (mini-Gsi chimera) bound to Piclidenoson (CF101,…

Browse structure collections

About this viewer

MolViewer shows 9EHS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.