9FMN: Human PADI6

Structure of Human PADI6. Determined by X-ray diffraction at 2.44 Å resolution. Released 2 Oct 2024.

Method: X-ray diffraction
Resolution: 2.44 Å
Organism: Homo sapiens
Chains: 2
Atoms: 10,224
Mol. weight: 155.61 kDa
Released: 2 Oct 2024

Explore 9FMN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9FMN contains 50 α-helices and 103 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 50 β-strands

Element	Residues	Length	Sheet
β-strand	14-15	2	1
β-strand	23-28	6	2
β-strand	33-36	4	1
β-strand	47-52	6	2
β-strand	56-60	5	1
α-helix	74	1
β-strand	75-76	2	2
β-strand	82-87	6	1
β-strand	97-104	8	2
β-strand	111-122	12	2
β-strand	123-128	6	3
α-helix	144-146	3
β-strand	157-159	3	4
β-strand	161	1	3
β-strand	179-181	3	3
β-strand	190-197	8	3
α-helix	200-203	4
β-strand	207-211	5	4
α-helix	214-217	4
β-strand	220-225	6	3
β-strand	232-237	6	3
β-strand	238	1	5
β-strand	241	1	5
β-strand	243-247	5	4
β-strand	254-261	8	3
β-strand	266	1	6
β-strand	269	1	6
β-strand	272-281	10	4
α-helix	289-290	2
β-strand	291-302	12	4
α-helix	303-305	3
β-strand	306-307	2	7
α-helix	313	1
β-strand	314-320	7	8
α-helix	328-338	11
β-strand	342-345	4	8
α-helix	346-349	4
α-helix	356-359	4
β-strand	361-368	8	7
β-strand	371-378	8	7
α-helix	394	1
β-strand	399-402	4	7
β-strand	419-421	3	9
α-helix	422-423	2
β-strand	425-427	3	10
β-strand	430-432	3	10
β-strand	437-441	5	9
α-helix	454-461	8
β-strand	469-472	4	9
β-strand	476	1	11
α-helix	481-483	3
β-strand	485-489	5	12
α-helix	492-495	4
β-strand	500-506	7	12
α-helix	507-519	13
β-strand	526-527	2	13
α-helix	533-536	4
β-strand	544-545	2	13
α-helix	546-549	4
α-helix	553-576	24
α-helix	581-583	3
β-strand	584-588	5	12
β-strand	591-595	5	11
α-helix	601-603	3
β-strand	608-612	5	11
β-strand	621-623	3	14
β-strand	626-630	5	14
α-helix	631	1
β-strand	636-637	2	15
β-strand	640-641	2	15
α-helix	642-651	10
α-helix	652-654	3
β-strand	657-661	5	14
α-helix	664-667	4
β-strand	677-682	6	8
α-helix	683-685	3
α-helix	689-691	3

Chain B: 23 helices, 53 β-strands

Element	Residues	Length	Sheet
β-strand	14-16	3	16
β-strand	23-28	6	17
β-strand	33-36	4	16
β-strand	47-52	6	17
β-strand	56-60	5	16
β-strand	75-76	2	17
β-strand	82-87	6	16
β-strand	97-104	8	17
β-strand	111-122	12	17
β-strand	123-128	6	18
α-helix	144-146	3
β-strand	149	1	19
β-strand	155	1	19
β-strand	157-159	3	20
β-strand	161	1	18
β-strand	180-181	2	18
β-strand	190-197	8	18
α-helix	200-203	4
β-strand	206-211	6	20
α-helix	214-217	4
β-strand	220-225	6	18
β-strand	232-237	6	18
β-strand	238	1	21
β-strand	241	1	21
β-strand	243-247	5	20
β-strand	252-261	10	18
β-strand	266	1	22
β-strand	269	1	22
β-strand	272-281	10	20
β-strand	291-302	12	20
β-strand	306-307	2	23
α-helix	313	1
β-strand	314-320	7	24
α-helix	328-338	11
β-strand	342-345	4	24
α-helix	356-359	4
β-strand	361-367	7	23
β-strand	372-378	7	23
α-helix	394-395	2
β-strand	399-402	4	23
β-strand	419-421	3	25
α-helix	422-423	2
β-strand	425-427	3	26
β-strand	430-432	3	26
β-strand	437-441	5	25
β-strand	451	1	25
α-helix	454-462	9
β-strand	469-472	4	25
β-strand	476	1	27
α-helix	481-483	3
β-strand	485-489	5	28
α-helix	492-495	4
β-strand	500-506	7	28
α-helix	507-517	11
α-helix	518-522	5
β-strand	526-527	2	29
α-helix	533-538	6
β-strand	544-545	2	29
α-helix	546-551	6
α-helix	553-577	25
α-helix	581-583	3
β-strand	584-588	5	28
β-strand	591-594	4	27
α-helix	601-603	3
β-strand	609-612	4	27
β-strand	621-623	3	30
β-strand	626-630	5	30
α-helix	631	1
β-strand	636-637	2	31
β-strand	640-641	2	31
α-helix	642-651	10
α-helix	652-654	3
β-strand	657-661	5	30
α-helix	664-668	5
β-strand	677-682	6	24
α-helix	689-691	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein-arginine deiminase type-6	A, B	protein	694	Homo sapiens	Q6TGC4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9FMN_1 Protein-arginine deiminase type-6 (chains A, B)
MVSVEGRAMSFQSIIHLSLDSPVHAVCVLGTEICLDLSGCAPQKCQCFTIHGSGRVLIDV
ANTVISEKEDATIWWPLSDPTYATVKMTSPSPSVDADKVSVTYYGPNEDAPVGTAVLYLT
GIEVSLEVDIYRNGQVEMSSDKQAKKKWIWGPSGWGAILLVNCNPADVGQQLEDKKTKKV
IFSEEITNLSQMTLNVQGPSCILKKYRLVLHTSKEESKKARVYWPQKDNSSTFELVLGPD
QHAYTLALLGNHLKETFYVEAIAFPSAEFSGLISYSVSLVEESQDPSIPETVLYKDTVVF
RVAPCVFIPCTQVPLEVYLCRELQLQGFVDTVTKLSEKSNSQVASVYEDPNRLGRWLQDE
MAFCYTQAPHKTTSLILDTPQAADLDEFPMKYSLSPGIGYMIQDTEDHKVASMDSIGNLM
VSPPVKVQGKEYPLGRVLIGSSFYPSAEGRAMSKTLRDFLYAQQVQAPVELYSDWLMTGH
VDEFMCFIPTDDKNEGKKGFLLLLASPSACYKLFREKQKEGYGDALLFDELRADQLLSNG
REAKTIDQLLADESLKKQNEYVEKCIHLNRDILKTELGLVEQDIIEIPQLFCLEKLTNIP
SDQQPKRSFARPYFPDLLRMIVMGKNLGIPKPFGPQIKGTCCLEEKICCLLEPLGFKCTF
INDFDCYLTEVGDICACANIRRVPFAFKWWKMVP

Primary citation

Structural insight into the function of human peptidyl arginine deiminase 6. Williams, J.P.C., Mouilleron, S., Trapero, R.H. et al. Comput Struct Biotechnol J (2024) 23:3258-3269. DOI 10.1016/j.csbj.2024.08.019 · PubMed

Other PDB entries of the same protein (UniProt Q6TGC4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DAT 1.4 Å, Structure of 14-3-3 sigma in complex with PADI6 14-3-3 binding motif II
8QL0 1.68 Å, Structure of human PAD6 Phosphomimic mutant V10E/S446E, apo
4DAU 2.0 Å, Structure of 14-3-3 sigma in complex with PADI6 14-3-3 binding motif I
9LPK 3.03 Å, Structure of human PADI6-UHRF1-UBE2D3 complex

Browse structure collections

About this viewer

MolViewer shows 9FMN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.