Structure of a gp140 SpyTag-SpyCatcher mi3 nanoparticle including mi3 density only. Determined by electron microscopy at 5.3 Å resolution. Released 9 Oct 2024.
Explore 9FO3 in 3D Show helices and sheets RCSB PDB PDBe
9FO3 contains 660 α-helices and 600 β-strands across 60 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 116-123 | 8 | |
| β-strand | 125-129 | 5 | 5 |
| α-helix | 134-146 | 13 | |
| β-strand | 151-155 | 5 | 5 |
| α-helix | 161-167 | 7 | |
| α-helix | 170-173 | 4 | |
| β-strand | 177-181 | 5 | 5 |
| α-helix | 186-194 | 9 | |
| β-strand | 199-201 | 3 | 5 |
| α-helix | 207-216 | 10 | |
| β-strand | 219-221 | 3 | 5 |
| β-strand | 223-224 | 2 | 6 |
| α-helix | 227-235 | 9 | |
| β-strand | 240-243 | 4 | 6 |
| α-helix | 246-258 | 13 | |
| β-strand | 265-268 | 4 | 6 |
| β-strand | 269 | 1 | 5 |
| α-helix | 277-283 | 7 | |
| β-strand | 288-290 | 3 | 5 |
| α-helix | 292-295 | 4 | |
| α-helix | 299-317 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 116-123 | 8 | |
| β-strand | 125-129 | 5 | 29 |
| α-helix | 134-146 | 13 | |
| β-strand | 151-155 | 5 | 29 |
| α-helix | 161-167 | 7 | |
| α-helix | 170-173 | 4 | |
| β-strand | 177-181 | 5 | 29 |
| α-helix | 186-194 | 9 | |
| β-strand | 199-201 | 3 | 29 |
| α-helix | 207-216 | 10 | |
| β-strand | 219-221 | 3 | 29 |
| β-strand | 223-224 | 2 | 30 |
| α-helix | 227-235 | 9 | |
| β-strand | 240-243 | 4 | 30 |
| α-helix | 246-257 | 12 | |
| β-strand | 265-268 | 4 | 30 |
| β-strand | 269 | 1 | 29 |
| α-helix | 277-283 | 7 | |
| β-strand | 288-290 | 3 | 29 |
| α-helix | 292-295 | 4 | |
| α-helix | 299-317 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CAP255 gp140 SpyTag-SpyCatcher mi3,2-dehydro-3-deoxyphosphogluconate… | 0, 1, 2, 3, 4, 5, 6, 7, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t, u, v, w, x, y, z | protein | 318 | Thermotoga maritima | Q9WXS1 (AlphaFold model) |
>9FO3_1 CAP255 gp140 SpyTag-SpyCatcher mi3,2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase,2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (chains 0, 1, 2, 3, 4, 5, 6, 7, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t, u, v, w, x, y, z) HHHHHHGSGDSATHIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGK YTFVETAAPDGYEVATAITFTVNEQGQVTVNGKATKGDAHIGGSGGSGGSGGSMKMEELF KKHKIVAVLRANSVEEAKKKALAVFLGGVHLIEITFTVPDADTVIKELSFLKEMGAIIGA GTVTSVEQARKAVESGAEFIVSPHLDEEISQFAKEKGVFYMPGVMTPTELVKAMKLGHTI LKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGSALVKGTPV EVAEKAKAFVEKIRGCTE
Development of a Two-Component Nanoparticle Vaccine Displaying an HIV-1 Envelope Glycoprotein that Elicits Tier 2 Neutralising Antibodies. Malebo, K., Woodward, J., Ximba, P. et al. Vaccines (Basel) (2024) 12. DOI 10.3390/vaccines12091063 · PubMed
Other PDB entries of the same protein (UniProt Q9WXS1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9FO3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.