9H7L: Human Transthyretin

Human Transthyretin in Complex with 4-phenyl-1H-pyrazolo[3,4-b]pyridin-3-amine. Determined by X-ray diffraction at 1.18 Å resolution. Released 12 Mar 2025.

Method: X-ray diffraction
Resolution: 1.18 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,794
Mol. weight: 28.06 kDa
Ligands: A1IS0, CA
Released: 12 Mar 2025

Explore 9H7L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9H7L contains 2 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
β-strand	23-24	2	1
β-strand	29-35	7	2
β-strand	41-48	8	2
β-strand	54-55	2	1
β-strand	67-73	7	2
α-helix	75-81	7
β-strand	88	1	3
β-strand	91-97	7	2
β-strand	104-112	9	1
β-strand	115-123	9	1

Chain B: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	1
β-strand	23-24	2	1
β-strand	29-35	7	3
β-strand	41-48	8	3
β-strand	54-55	2	1
β-strand	67-73	7	3
α-helix	75-81	7
β-strand	88	1	2
β-strand	91-97	7	3
β-strand	105-112	8	1
β-strand	115-122	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transthyretin	A, B	protein	127	Homo sapiens	P02766 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9H7L_1 Transthyretin (chains A, B)
GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTT
EEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTA
VVTNPKE

Ligands and cofactors

ID	Name	Formula	Copies
A1IS0	4-phenyl-2H-pyrazolo[3,4-b]pyridin-3-amine	C12 H10 N4	2
CA	Calcium ion	Ca	2

Primary citation

Fragment-based drug discovery for transthyretin kinetic stabilisers using a novel capillary zone electrophoresis method. Chen, W. PLoS One (2025) 20:e0323816-e0323816. DOI 10.1371/journal.pone.0323816 · PubMed

Other PDB entries of the same protein (UniProt P02766 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F86 1.1 Å, Transthyretin THR119MET protein stabilisation
8C86 1.1 Å, Crystal structure of human transthyretin in complex with 3-O-methyltolcapone analogue 2
8W45 1.1 Å, X-ray crystal structure of V30M-TTR in complex with pinostilbene
4QXV 1.12 Å, Crystal structure of human transthyretin in complex with luteolin at 1.1 a resolution
4KY2 1.13 Å, Transthyretin in complex with the fluorescent folding sensor…
4D7B 1.15 Å, Structure of human transthyretin in complex with Tolcapone
7EJQ 1.15 Å, Crystal structure of human transthyretin in complex with…
8AWI 1.15 Å, Crystal structure of Human Transthyretin at 1.15 Angstrom resolution
6TXW 1.15 Å, V30G Transthyretin structure in complex with Tolcalpone
4L1T 1.16 Å, Transthyretin in complex with (E)-3-(dimethylamino)-5-(4-hydroxy-3,5-dimethylstyryl)benzo…
4HIQ 1.18 Å, The Structure of V122I Mutant Transthyretin in Complex with AG10
8C85 1.19 Å, Crystal structure of human transthyretin in complex with 3-O-methyltolcapone analogue 1

Browse structure collections

About this viewer

MolViewer shows 9H7L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.