9HFW: SRC-3 (NCoA-3) peptide

SRC-3 (NCoA-3) peptide bound to SPOP MATH domain. Determined by X-ray diffraction at 1.7 Å resolution. Released 23 Apr 2025.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,340
Mol. weight: 17.88 kDa
Released: 23 Apr 2025

Explore 9HFW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HFW contains 7 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	31-38	8	1
α-helix	41-43	3
α-helix	46-47	2
β-strand	52-53	2	2
α-helix	54-56	3
β-strand	57	1	2
β-strand	66-72	7	2
α-helix	78-80	3
β-strand	83-92	10	2
β-strand	98-107	10	1
β-strand	113-118	6	1
β-strand	123-125	3	1
β-strand	130-138	9	2
α-helix	139-142	4
α-helix	145-147	3
α-helix	151-153	3
β-strand	155-163	9	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	101	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Speckle type BTB/POZ protein	A	protein	139	Homo sapiens	D6RDG8 (AlphaFold model)
Nuclear receptor coactivator 3	B	protein	17	Homo sapiens	Q9Y6Q9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9HFW_1 Speckle type BTB/POZ protein (chains A)
KVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLY
LLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEAN
GLLPDDKLTLFCEVSVVQD

Sequence of entity 2 (B), FASTA

>9HFW_2 Nuclear receptor coactivator 3 (chains B)
NDDDVQKADVSSTGQGV

Primary citation

Sequence rules for a long SPOP-binding degron required for protein ubiquitylation. Makhlouf, L., Mishra, M., Makhlouf, H. et al. Biochem J (2025) 482:583-600. DOI 10.1042/BCJ20253041 · PubMed

Other PDB entries of the same protein (UniProt D6RDG8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7KPI 1.7 Å, Crystal structure of the SPOP MATH domain
9HFU 1.7 Å, Caprin1 peptide bound to SPOP MATH domain
7KPK 1.71 Å, Crystal structure of the SPOP MATH domain in complex with a fragment of Pdx1
9HGH 1.9 Å, MyD88 peptide_1 bound to SPOP MATH domain

Browse structure collections

About this viewer

MolViewer shows 9HFW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.