9HVD: Native human P-eIF2-eIF2B complex
Native human P-eIF2-eIF2B complex. Determined by electron microscopy at 3.04 Å resolution. Released 19 Nov 2025.
- Method
- Electron microscopy
- Resolution
- 3.04 Å
- Organism
- Homo sapiens
- Chains
- 12
- Atoms
- 31,306
- Mol. weight
- 594.89 kDa
- Released
- 19 Nov 2025
Explore 9HVD in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9HVD contains 173 α-helices and 221 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 16 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-16 | 14 | |
| α-helix | 22-35 | 14 | |
| α-helix | 42-59 | 18 | |
| α-helix | 63-75 | 13 | |
| α-helix | 86-104 | 19 | |
| α-helix | 107-115 | 9 | |
| α-helix | 116-118 | 3 | |
| β-strand | 123-126 | 4 | 44 |
| α-helix | 132-142 | 11 | |
| β-strand | 148-153 | 6 | 44 |
| α-helix | 160-169 | 10 | |
| β-strand | 175-178 | 4 | 44 |
| α-helix | 183-186 | 4 | |
| β-strand | 192-195 | 4 | 44 |
| β-strand | 200 | 1 | 45 |
| β-strand | 206-209 | 4 | 45 |
| α-helix | 212-221 | 10 | |
| β-strand | 226-229 | 4 | 44 |
| α-helix | 232-234 | 3 | |
| β-strand | 235 | 1 | 45 |
| α-helix | 243-245 | 3 | |
| α-helix | 248-251 | 4 | |
| β-strand | 273-276 | 4 | 45 |
| α-helix | 278-280 | 3 | |
| β-strand | 283-286 | 4 | 44 |
| β-strand | 289-291 | 3 | 44 |
| α-helix | 296-303 | 8 | |
Chain B: 16 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-16 | 14 | |
| α-helix | 22-35 | 14 | |
| α-helix | 43-59 | 17 | |
| α-helix | 63-76 | 14 | |
| α-helix | 86-104 | 19 | |
| α-helix | 108-115 | 8 | |
| α-helix | 116-118 | 3 | |
| β-strand | 123-126 | 4 | 24 |
| α-helix | 132-142 | 11 | |
| β-strand | 148-153 | 6 | 24 |
| α-helix | 160-169 | 10 | |
| β-strand | 175-178 | 4 | 24 |
| α-helix | 183-186 | 4 | |
| α-helix | 187-189 | 3 | |
| β-strand | 192-195 | 4 | 24 |
| β-strand | 200 | 1 | 25 |
| β-strand | 206-209 | 4 | 25 |
| α-helix | 212-221 | 10 | |
| β-strand | 226-229 | 4 | 24 |
| α-helix | 232-234 | 3 | |
| β-strand | 235 | 1 | 25 |
| α-helix | 248-251 | 4 | |
| β-strand | 273-276 | 4 | 25 |
| α-helix | 278-280 | 3 | |
| β-strand | 283-286 | 4 | 24 |
| β-strand | 289-291 | 3 | 24 |
| α-helix | 293-303 | 11 | |
Chain C: 20 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-23 | 17 | |
| α-helix | 31-47 | 17 | |
| α-helix | 54-71 | 18 | |
| α-helix | 77-97 | 21 | |
| α-helix | 129-145 | 17 | |
| α-helix | 148-152 | 5 | |
| α-helix | 155-157 | 3 | |
| β-strand | 164-168 | 5 | 29 |
| α-helix | 172-181 | 10 | |
| β-strand | 188-192 | 5 | 29 |
| α-helix | 200-209 | 10 | |
| β-strand | 213-217 | 5 | 29 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-225 | 4 | |
| α-helix | 226-228 | 3 | |
| β-strand | 231-234 | 4 | 29 |
| β-strand | 238-239 | 2 | 43 |
| β-strand | 245-248 | 4 | 43 |
| α-helix | 251-260 | 10 | |
| β-strand | 265-268 | 4 | 29 |
| α-helix | 271-273 | 3 | |
| β-strand | 274 | 1 | 43 |
| α-helix | 291-293 | 3 | |
| α-helix | 297-302 | 6 | |
| β-strand | 306-308 | 3 | 26 |
| β-strand | 313-316 | 4 | 43 |
| α-helix | 318-320 | 3 | |
| β-strand | 323-325 | 3 | 29 |
| β-strand | 330-331 | 2 | 29 |
| α-helix | 333-335 | 3 | |
| α-helix | 336-341 | 6 | |
| α-helix | 346-349 | 4 | |
Chain D: 18 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-23 | 15 | |
| α-helix | 31-47 | 17 | |
| α-helix | 54-71 | 18 | |
| α-helix | 77-96 | 20 | |
| α-helix | 129-145 | 17 | |
| α-helix | 148-152 | 5 | |
| α-helix | 155-157 | 3 | |
| β-strand | 164-168 | 5 | 20 |
| α-helix | 172-181 | 10 | |
| β-strand | 188-192 | 5 | 20 |
| α-helix | 200-209 | 10 | |
| β-strand | 213-217 | 5 | 20 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-225 | 4 | |
| α-helix | 226-228 | 3 | |
| β-strand | 231-234 | 4 | 20 |
| β-strand | 238-239 | 2 | 21 |
| β-strand | 245-248 | 4 | 21 |
| α-helix | 251-261 | 11 | |
| β-strand | 265-268 | 4 | 20 |
| α-helix | 271-273 | 3 | |
| β-strand | 274 | 1 | 21 |
| β-strand | 288 | 1 | 22 |
| α-helix | 291-293 | 3 | |
| β-strand | 306-308 | 3 | 23 |
| β-strand | 311 | 1 | 22 |
| β-strand | 313-316 | 4 | 21 |
| α-helix | 318-320 | 3 | |
| β-strand | 323-325 | 3 | 20 |
| β-strand | 330-331 | 2 | 20 |
| α-helix | 336-341 | 6 | |
| α-helix | 346-349 | 4 | |
Chain E: 13 helices, 31 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-8 | 6 | 30 |
| α-helix | 16-18 | 3 | |
| α-helix | 25-27 | 3 | |
| α-helix | 37-46 | 10 | |
| β-strand | 52-55 | 4 | 30 |
| α-helix | 57-60 | 4 | |
| β-strand | 76-77 | 2 | 30 |
| α-helix | 87-92 | 6 | |
| α-helix | 94-96 | 3 | |
| β-strand | 100-103 | 4 | 30 |
| β-strand | 108 | 1 | 31 |
| α-helix | 115-124 | 10 | |
| β-strand | 128-134 | 7 | 30 |
| β-strand | 156-161 | 6 | 32 |
| β-strand | 166 | 1 | 30 |
| β-strand | 167-172 | 6 | 32 |
| β-strand | 179-182 | 4 | 33 |
| β-strand | 192-196 | 5 | 32 |
| β-strand | 199-201 | 3 | 30 |
| β-strand | 206-207 | 2 | 30 |
| α-helix | 209-216 | 8 | |
| α-helix | 224-228 | 5 | |
| α-helix | 229-235 | 7 | |
| α-helix | 263-266 | 4 | |
| β-strand | 301-305 | 5 | 30 |
| β-strand | 312 | 1 | 31 |
| α-helix | 316-321 | 6 | |
| α-helix | 326-333 | 8 | |
| β-strand | 344-345 | 2 | 34 |
| β-strand | 352 | 1 | 35 |
| β-strand | 357 | 1 | 36 |
| β-strand | 362-363 | 2 | 34 |
| β-strand | 368-371 | 4 | 35 |
| β-strand | 374-375 | 2 | 36 |
| β-strand | 380 | 1 | 34 |
| β-strand | 385-388 | 4 | 35 |
| β-strand | 391-392 | 2 | 36 |
| β-strand | 397-398 | 2 | 34 |
| β-strand | 403-405 | 3 | 35 |
| β-strand | 409 | 1 | 36 |
| β-strand | 414-415 | 2 | 34 |
| β-strand | 420-422 | 3 | 35 |
| β-strand | 426 | 1 | 36 |
| β-strand | 432 | 1 | 34 |
Chain F: 10 helices, 32 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-8 | 6 | 1 |
| β-strand | 29-30 | 2 | 2 |
| β-strand | 33-34 | 2 | 2 |
| α-helix | 37-46 | 10 | |
| β-strand | 51-55 | 5 | 1 |
| α-helix | 57-63 | 7 | |
| β-strand | 74-77 | 4 | 1 |
| α-helix | 86-92 | 7 | |
| α-helix | 94-96 | 3 | |
| β-strand | 100-105 | 6 | 1 |
| β-strand | 108-110 | 3 | 3 |
| α-helix | 115-123 | 9 | |
| β-strand | 128-134 | 7 | 4 |
| β-strand | 156-160 | 5 | 5 |
| β-strand | 166 | 1 | 4 |
| β-strand | 167-172 | 6 | 5 |
| β-strand | 179-183 | 5 | 6 |
| β-strand | 192-193 | 2 | 7 |
| β-strand | 194-196 | 3 | 5 |
| β-strand | 199-202 | 4 | 4 |
| α-helix | 209-216 | 8 | |
| α-helix | 224-228 | 5 | |
| α-helix | 229-235 | 7 | |
| α-helix | 263-266 | 4 | |
| β-strand | 300-305 | 6 | 4 |
| β-strand | 310-312 | 3 | 3 |
| α-helix | 317-333 | 17 | |
| β-strand | 340 | 1 | 8 |
| β-strand | 357 | 1 | 9 |
| β-strand | 358 | 1 | 8 |
| β-strand | 363 | 1 | 10 |
| β-strand | 370-371 | 2 | 11 |
| β-strand | 374 | 1 | 9 |
| β-strand | 380 | 1 | 10 |
| β-strand | 386-388 | 3 | 11 |
| β-strand | 391 | 1 | 12 |
| β-strand | 396-397 | 2 | 10 |
| β-strand | 403-405 | 3 | 11 |
| β-strand | 408 | 1 | 12 |
| β-strand | 413-414 | 2 | 10 |
| β-strand | 420-422 | 3 | 11 |
| β-strand | 431 | 1 | 10 |
Chain G: 18 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 205-216 | 12 | |
| α-helix | 224-238 | 15 | |
| α-helix | 248-266 | 19 | |
| α-helix | 271-286 | 16 | |
| α-helix | 293-308 | 16 | |
| α-helix | 309-313 | 5 | |
| α-helix | 314-323 | 10 | |
| α-helix | 324-326 | 3 | |
| β-strand | 332-336 | 5 | 26 |
| α-helix | 340-351 | 12 | |
| β-strand | 357-362 | 6 | 26 |
| α-helix | 369-379 | 11 | |
| β-strand | 383-387 | 5 | 26 |
| α-helix | 388-390 | 3 | |
| α-helix | 391-394 | 4 | |
| β-strand | 400-403 | 4 | 26 |
| β-strand | 407-408 | 2 | 27 |
| β-strand | 414-417 | 4 | 27 |
| α-helix | 420-429 | 10 | |
| β-strand | 434-437 | 4 | 26 |
| α-helix | 440-442 | 3 | |
| β-strand | 443 | 1 | 27 |
| α-helix | 460-463 | 4 | |
| β-strand | 467 | 1 | 28 |
| β-strand | 470 | 1 | 28 |
| α-helix | 476-478 | 3 | |
| β-strand | 482-484 | 3 | 29 |
| β-strand | 489-492 | 4 | 27 |
| β-strand | 499-502 | 4 | 26 |
| β-strand | 505-507 | 3 | 26 |
| α-helix | 509-511 | 3 | |
| α-helix | 512-516 | 5 | |
Chain H: 18 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 193-195 | 3 | |
| α-helix | 205-214 | 10 | |
| α-helix | 224-238 | 15 | |
| α-helix | 248-266 | 19 | |
| α-helix | 271-286 | 16 | |
| α-helix | 293-308 | 16 | |
| α-helix | 309-313 | 5 | |
| α-helix | 314-323 | 10 | |
| α-helix | 324-326 | 3 | |
| β-strand | 332-336 | 5 | 23 |
| α-helix | 340-351 | 12 | |
| β-strand | 357-362 | 6 | 23 |
| α-helix | 369-379 | 11 | |
| β-strand | 383-387 | 5 | 23 |
| α-helix | 388-390 | 3 | |
| α-helix | 391-394 | 4 | |
| β-strand | 400-403 | 4 | 23 |
| β-strand | 407-408 | 2 | 46 |
| β-strand | 414-417 | 4 | 46 |
| α-helix | 420-429 | 10 | |
| β-strand | 434-437 | 4 | 23 |
| β-strand | 443 | 1 | 46 |
| α-helix | 460-463 | 4 | |
| β-strand | 483-484 | 2 | 20 |
| β-strand | 489-492 | 4 | 46 |
| α-helix | 494-496 | 3 | |
| β-strand | 499-502 | 4 | 23 |
| β-strand | 505-507 | 3 | 23 |
| α-helix | 509-511 | 3 | |
| α-helix | 512-517 | 6 | |
4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Translation initiation factor eIF-2B subunit gamma | E, F | protein | 452 | Homo sapiens | Q9NR50 (AlphaFold model) |
| Eukaryotic translation initiation factor 2 subunit 1 | K, L | protein | 315 | Homo sapiens | P05198 (AlphaFold model) |
| Translation initiation factor eIF2B subunit epsilon | I, J | protein | 721 | Homo sapiens | Q13144 (AlphaFold model) |
| Translation initiation factor eIF2B subunit beta | C, D | protein | 351 | Homo sapiens | P49770 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit alpha | A, B | protein | 305 | Homo sapiens | Q14232 |
| Translation initiation factor eIF-2B subunit delta | G, H | protein | 523 | Homo sapiens | Q9UI10 |
Sequence of entity 1 (E, F), FASTA
>9HVD_1 Translation initiation factor eIF-2B subunit gamma (chains E, F)
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQ
KALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDL
FRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEEL
VIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC
YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP
ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
Sequence of entity 2 (K, L), FASTA
>9HVD_2 Eukaryotic translation initiation factor 2 subunit 1 (chains K, L)
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
Sequence of entity 3 (I, J), FASTA
>9HVD_3 Translation initiation factor eIF2B subunit epsilon (chains I, J)
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPIS
KDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVV
RIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSV
MTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARV
SNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENV
LLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDS
RGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVV
LEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALG
ISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D
Sequence of entity 4 (C, D), FASTA
>9HVD_4 Translation initiation factor eIF2B subunit beta (chains C, D)
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL
Sequence of entity 5 (A, B), FASTA
>9HVD_5 Translation initiation factor eIF-2B subunit alpha (chains A, B)
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVD
SSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIK
DGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLD
AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL
IKLYL
Sequence of entity 6 (G, H), FASTA
>9HVD_6 Translation initiation factor eIF-2B subunit delta (chains G, H)
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
Primary citation
Termination of the integrated stress response. De Miguel, C., Thorkelsson, S.R., Fatalska, A. et al. Science (2026) 391:eadw5137-eadw5137. DOI 10.1126/science.adw5137 · PubMed
Other PDB entries of the same protein (UniProt Q9NR50 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9Y4B 2.1 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 7VLK 2.27 Å, eIF2B-SFSV NSs C2-imposed
- 9Y3U 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 9Y4W 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 7F64 2.42 Å, eIF2B-SFSV NSs
- 9Y3T 2.5 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 7RLO 2.6 Å, Structure of the human eukaryotic translation initiation factor 2B (eIF2B) in complex…
- 9HVE 2.7 Å, Native human eIF2-eIF2B complex
- 7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2
- 9Y5T 2.78 Å, eIF2B lacking the latch helix bound to ISRACT-02 (Active state)
- 6CAJ 2.8 Å, Electron cryo-microscopy of the eukaryotic translation initiation factor 2B from Homo…
- 7L70 2.8 Å, The eukaryotic translation initiation factor 2B from Homo sapiens in its apo form
Browse structure collections
About this viewer
MolViewer shows 9HVD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.