9HWG: Transcribing Pol II-TCR-RECQL5 complex

Name: PDB 9HWG: Structure of the transcribing Pol II-TCR-RECQL5 complex
Published: 2025-07-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Structure of the transcribing Pol II-TCR-RECQL5 complex. Determined by electron microscopy at 3.5 Å resolution. Released 16 Jul 2025.

Method: Electron microscopy
Resolution: 3.5 Å
Organisms: Sus scrofa domesticus, synthetic construct, Homo sapiens
Chains: 21
Atoms: 51,212
Mol. weight: 1100.44 kDa
Ligands: MG, ZN
Released: 16 Jul 2025

Explore 9HWG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HWG contains 256 α-helices and 384 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 3 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	2-10	9
α-helix	15-28	14
β-strand	30-32	3	78
β-strand	36-38	3	79
β-strand	46-51	6	80
β-strand	58-63	6	80
β-strand	68-72	5	80
β-strand	82-84	3	79
β-strand	86-90	5	80
β-strand	102-107	6	81
α-helix	108	1
β-strand	114-119	6	81
β-strand	123-128	6	81
β-strand	133-139	7	81
β-strand	144-149	6	82
β-strand	158-163	6	82
β-strand	168-172	5	82
β-strand	177	1	82
β-strand	181-182	2	82
β-strand	191-194	4	83
β-strand	201-206	6	83
β-strand	210-215	6	83
β-strand	222-225	4	83
β-strand	248-253	6	84
β-strand	259-264	6	84
β-strand	268-273	6	84
β-strand	279	1	84
β-strand	296	1	78
β-strand	298-299	2	85
β-strand	307-312	6	85
β-strand	315-320	6	85
β-strand	326-330	5	85
β-strand	337-343	7	78
β-strand	348-353	6	78
β-strand	358-363	6	78

Chain A: 77 helices, 72 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15	1	1
β-strand	20-22	3	2
β-strand	25	1	3
α-helix	26-27	2
α-helix	28-34	7
β-strand	47-48	2	4
β-strand	51-52	2	4
α-helix	60-62	3
α-helix	81-83	3
β-strand	86-95	10	5
α-helix	100-107	8
β-strand	110	1	6
β-strand	117	1	6
α-helix	124-132	9
α-helix	137-150	14
α-helix	186-189	4
β-strand	190-194	5	7
β-strand	197-201	5	7
β-strand	213-216	4	7
α-helix	218-227	10
α-helix	230-235	6
α-helix	245-248	4
β-strand	249-255	7	5
β-strand	264-265	2	8
β-strand	271-272	2	8
α-helix	275-295	21
α-helix	300-318	19
α-helix	326-328	3
β-strand	329	1	9
β-strand	335	1	9
α-helix	339-343	5
α-helix	349-353	5
β-strand	357-359	3	10
β-strand	362-369	8	11
β-strand	377-381	5	11
α-helix	382-387	6
β-strand	389-393	5	12
α-helix	394	1
α-helix	399-408	10
β-strand	416-420	5	12
β-strand	426-428	3	12
α-helix	436-438	3
β-strand	445-449	5	12
α-helix	450	1
β-strand	455-459	5	11
α-helix	466-468	3
β-strand	469-477	9	11
β-strand	482-484	3	11
α-helix	486-488	3
α-helix	489-492	4
β-strand	500-504	5	11
α-helix	509-514	6
α-helix	515-519	5
β-strand	520	1	11
α-helix	521-524	4
β-strand	526-527	2	13
β-strand	532-533	2	13
α-helix	539-548	10
β-strand	554-555	2	14
α-helix	557-565	9
α-helix	574	1
β-strand	575	1	15
α-helix	576-577	2
β-strand	579-581	3	16
β-strand	585	1	16
β-strand	586-587	2	14
α-helix	588-595	8
β-strand	602-604	3	17
β-strand	628-631	4	17
β-strand	634-637	4	17
α-helix	642-645	4
α-helix	652-659	8
α-helix	662-683	22
β-strand	686	1	18
α-helix	689-692	4
α-helix	696-721	26
α-helix	727-728	2
α-helix	733-759	27
α-helix	765-772	8
α-helix	778-785	8
β-strand	789-790	2	19
β-strand	792-793	2	20
β-strand	796-797	2	20
α-helix	798-799	2
β-strand	802	1	21
β-strand	805	1	21
β-strand	822-823	2	19
α-helix	833-868	36
β-strand	872-873	2	22
β-strand	879-880	2	22
β-strand	886-888	3	22
α-helix	891-893	3
β-strand	896	1	23
β-strand	902-905	4	24
α-helix	913-920	8
α-helix	927-933	7
β-strand	934	1	25
α-helix	936-944	9
α-helix	946-969	24
β-strand	976-979	4	24
α-helix	983-993	11
β-strand	1002	1	25
α-helix	1006-1019	14
α-helix	1028-1037	10
α-helix	1039-1048	10
α-helix	1051-1053	3
α-helix	1054-1058	5
α-helix	1062-1079	18
β-strand	1080	1	23
α-helix	1081-1082	2
α-helix	1087-1101	15
α-helix	1120-1129	10
β-strand	1139-1142	4	26
β-strand	1143	1	27
α-helix	1146-1149	4
α-helix	1151-1161	11
β-strand	1164-1165	2	28
α-helix	1166-1169	4
β-strand	1170-1177	8	29
β-strand	1180	1	30
β-strand	1183	1	30
α-helix	1187-1196	10
β-strand	1210-1216	7	29
α-helix	1218-1223	6
α-helix	1228-1239	12
β-strand	1243-1247	5	29
β-strand	1255-1261	7	29
α-helix	1281-1294	14
β-strand	1297-1299	3	28
β-strand	1307-1310	4	26
β-strand	1319-1322	4	31
β-strand	1328-1331	4	31
β-strand	1335-1338	4	26
α-helix	1343-1347	5
β-strand	1352	1	27
β-strand	1358-1359	2	26
α-helix	1362-1369	8
α-helix	1371-1387	17
α-helix	1395-1406	12
α-helix	1416-1420	5
α-helix	1426-1430	5
α-helix	1435-1445	11
β-strand	1448-1449	2	2
α-helix	1454-1459	6
α-helix	1462-1464	3
α-helix	1467-1469	3
β-strand	1471-1475	5	32
α-helix	1478-1480	3

Chain b: 28 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	491-492	2	86
β-strand	498-499	2	86
α-helix	501-506	6
α-helix	509-524	16
β-strand	528-530	3	87
α-helix	532-533	2
α-helix	539-551	13
β-strand	569-572	4	87
α-helix	575-577	3
α-helix	578-588	11
β-strand	594-597	4	87
α-helix	607-617	11
β-strand	620-623	4	87
α-helix	625-630	6
α-helix	632-635	4
β-strand	645-646	2	87
α-helix	648-651	4
α-helix	657-662	6
β-strand	671-673	3	87
α-helix	682-692	11
α-helix	700-703	4
α-helix	704-708	5
α-helix	709-713	5
α-helix	721-738	18
β-strand	742-743	2	87
β-strand	759-760	2	88
β-strand	765-766	2	89
α-helix	770-780	11
α-helix	783-789	7
α-helix	796-807	12
α-helix	835-837	3
α-helix	839-853	15
β-strand	858-862	5	88
α-helix	865-877	13
β-strand	882-885	4	88
α-helix	891-893	3
α-helix	894-903	10
β-strand	909-913	5	88
β-strand	928-931	4	88
α-helix	938-946	9
β-strand	957-961	5	88
β-strand	963-964	2	89
α-helix	968-987	20
α-helix	992-994	3
α-helix	1388-1398	11

Chain B: 59 helices, 85 β-strands

Element	Residues	Length	Sheet
α-helix	16-18	3
α-helix	19-37	19
α-helix	41-49	9
α-helix	50-54	5
α-helix	55-61	7
α-helix	63-65	3
β-strand	68	1	33
β-strand	83-84	2	33
β-strand	87-93	7	34
β-strand	97-99	3	35
β-strand	105-107	3	35
α-helix	110-116	7
β-strand	121-130	10	34
β-strand	132-133	2	33
β-strand	142-153	12	34
α-helix	168-173	6
β-strand	185-187	3	36
β-strand	190-193	4	36
α-helix	194-195	2
β-strand	196-200	5	37
α-helix	201	1
β-strand	206-209	4	38
β-strand	215-223	9	38
α-helix	232	1
β-strand	233-240	8	38
α-helix	241-242	2
β-strand	256-259	4	38
β-strand	263	1	39
β-strand	267-268	2	38
α-helix	269-276	8
α-helix	281-288	8
α-helix	295-307	13
α-helix	314-324	11
β-strand	325	1	39
α-helix	332-341	10
α-helix	342-346	5
α-helix	358-376	19
α-helix	381-384	4
α-helix	388-390	3
β-strand	391-394	4	37
α-helix	396-423	28
α-helix	431-434	4
α-helix	437-450	14
β-strand	453	1	40
β-strand	463	1	40
α-helix	464	1
β-strand	468-469	2	36
α-helix	470-471	2
α-helix	475-481	7
β-strand	484-486	3	37
α-helix	503-505	3
β-strand	509	1	41
β-strand	523-525	3	37
β-strand	526	1	41
β-strand	531-532	2	42
α-helix	539-547	9
β-strand	551-552	2	43
α-helix	558-560	3
β-strand	565-569	5	43
β-strand	572-577	6	43
α-helix	580-593	14
β-strand	602-606	5	43
β-strand	611-615	5	43
β-strand	621-627	7	42
β-strand	628	1	44
β-strand	633	1	44
α-helix	637-644	8
α-helix	646-649	4
α-helix	653-658	6
β-strand	662-666	5	42
α-helix	667-670	4
β-strand	675-676	2	42
α-helix	679-682	4
β-strand	695-696	2	42
α-helix	700-703	4
α-helix	708-710	3
α-helix	714-716	3
β-strand	717	1	45
α-helix	719-728	10
β-strand	732	1	46
β-strand	735	1	47
α-helix	740-742	3
β-strand	747-751	5	47
β-strand	755	1	48
β-strand	759-760	2	49
α-helix	762-765	4
β-strand	776-782	7	50
β-strand	783	1	18
β-strand	793-797	5	50
α-helix	798-802	5
β-strand	808-817	10	47
β-strand	827-829	3	51
β-strand	837	1	52
β-strand	848	1	53
β-strand	853	1	54
β-strand	854	1	53
α-helix	855	1
β-strand	859	1	47
β-strand	865-867	3	54
β-strand	869-871	3	51
β-strand	889	1	52
β-strand	890-891	2	51
β-strand	894-895	2	54
α-helix	896-897	2
β-strand	903-911	9	47
β-strand	917-927	11	47
β-strand	934-937	4	50
β-strand	942-949	8	50
α-helix	951-953	3
β-strand	956	1	55
β-strand	965-967	3	50
α-helix	972-975	4
β-strand	977	1	45
α-helix	978-993	16
α-helix	996	1
β-strand	997-998	2	49
α-helix	1008-1016	9
β-strand	1025-1026	2	50
β-strand	1029	1	55
α-helix	1035	1
β-strand	1036	1	55
α-helix	1037	1
β-strand	1041-1050	10	50
β-strand	1051	1	46
α-helix	1055-1057	3
β-strand	1060-1062	3	11
β-strand	1067	1	56
β-strand	1074	1	56
α-helix	1075	1
α-helix	1078-1080	3
β-strand	1084-1086	3	10
α-helix	1088-1097	10
α-helix	1100-1104	5
α-helix	1105-1109	5
β-strand	1115-1119	5	1
β-strand	1125	1	1
β-strand	1127-1129	3	57
β-strand	1134-1136	3	57
β-strand	1137	1	58
β-strand	1142	1	58
β-strand	1146-1150	5	1
α-helix	1153-1164	12
β-strand	1167	1	3
β-strand	1170-1172	3	2

Chain c: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	2-14	13
α-helix	22-34	13
α-helix	36-51	16
α-helix	55-71	17
α-helix	74-80	7
α-helix	83-90	8
α-helix	98-100	3
α-helix	102	1
α-helix	103-124	22
α-helix	129-136	8
α-helix	137-141	5

Chain C: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	59
β-strand	18-24	7	59
α-helix	28-40	13
β-strand	44-55	12	60
α-helix	61-69	9
β-strand	73	1	61
α-helix	78-81	4
α-helix	82-84	3
β-strand	99-106	8	60
α-helix	112	1
β-strand	113-116	4	62
α-helix	117-119	3
β-strand	121-122	2	60
β-strand	129	1	61
α-helix	130-132	3
α-helix	147-148	2
β-strand	149-153	5	62
β-strand	158-168	11	60
α-helix	174-176	3
β-strand	179-185	7	59
α-helix	200-202	3
α-helix	204-206	3
α-helix	218-220	3
β-strand	229-235	7	59
α-helix	241-268	28

Chain d: 12 helices, 98 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	90
β-strand	15-21	7	91
β-strand	30-35	6	91
β-strand	38-44	7	91
β-strand	49-56	8	91
β-strand	61-67	7	92
β-strand	76-81	6	92
β-strand	85-94	10	92
β-strand	97-107	11	92
β-strand	115	1	93
β-strand	121-124	4	94
β-strand	130-134	5	94
β-strand	136	1	93
β-strand	139-144	6	94
β-strand	155-158	4	94
β-strand	164-169	6	95
α-helix	170	1
β-strand	177-184	8	95
β-strand	187-196	10	95
β-strand	201-204	4	95
β-strand	210-211	2	95
β-strand	218-221	4	96
β-strand	229-232	4	96
β-strand	237-240	4	96
β-strand	245-248	4	96
α-helix	251-253	3
β-strand	258-263	6	97
β-strand	270-275	6	97
β-strand	279-288	10	97
β-strand	296-307	12	97
β-strand	313-318	6	98
β-strand	321-325	5	98
β-strand	331-336	6	98
β-strand	347-353	7	98
β-strand	361-364	4	99
α-helix	367-369	3
β-strand	375-379	5	99
β-strand	386-391	6	99
β-strand	398-400	3	100
β-strand	409-413	5	101
β-strand	424-428	5	101
β-strand	433-436	4	101
β-strand	445-446	2	101
β-strand	457-463	7	102
β-strand	467-472	6	102
β-strand	475-478	4	102
β-strand	488-491	4	102
α-helix	496-498	3
β-strand	500	1	103
β-strand	503	1	103
β-strand	507-512	6	103
β-strand	515-522	8	103
β-strand	525-533	9	103
β-strand	538-542	5	104
β-strand	555-560	6	104
β-strand	565-570	6	104
β-strand	575-581	7	104
β-strand	588-595	8	105
β-strand	600-606	7	105
β-strand	610-616	7	105
β-strand	624-630	7	105
β-strand	637-642	6	106
β-strand	647-652	6	106
β-strand	657-662	6	106
β-strand	665-670	6	106
β-strand	678	1	107
β-strand	682	1	108
β-strand	690	1	108
β-strand	693-694	2	107
β-strand	699-700	2	107
β-strand	701-702	2	100
β-strand	711-716	6	99
β-strand	720-727	8	109
β-strand	732-741	10	109
β-strand	751	1	109
α-helix	757-759	3
β-strand	762-765	4	109
β-strand	786-795	10	109
β-strand	801-806	6	109
β-strand	811-819	9	110
β-strand	828-835	8	110
β-strand	846-854	9	110
β-strand	857-866	10	110
β-strand	872-876	5	111
β-strand	879-884	6	111
β-strand	887-893	7	111
β-strand	899-905	7	111
β-strand	911-917	7	112
β-strand	920-925	6	112
β-strand	930-936	7	112
β-strand	941-948	8	112
β-strand	954-959	6	113
β-strand	964-969	6	113
β-strand	973-978	6	113
α-helix	987-990	4
β-strand	991	1	112
β-strand	993-999	7	113
β-strand	1004-1009	6	90
β-strand	1024-1032	9	90
β-strand	1037-1043	7	90
α-helix	1045-1061	17
α-helix	1070-1073	4
β-strand	1076-1078	3	114
β-strand	1081-1083	3	114
β-strand	1086	1	113
β-strand	1088-1090	3	90
α-helix	1091-1095	5
α-helix	1096-1099	4
α-helix	1102-1108	7
α-helix	1126-1137	12

Chain D: 8 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	24-28	5
β-strand	30-31	2	32
α-helix	34-49	16
α-helix	56-58	3
α-helix	59-71	13
α-helix	77-88	12
α-helix	94-102	9
α-helix	108-114	7
α-helix	124-136	13

10 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit	A	protein	1970	Sus scrofa domesticus	A0A8D1DPV6
DNA-directed RNA polymerase subunit beta	B	protein	1174	Sus scrofa domesticus	A0A0B8RVL1 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C	protein	275	Sus scrofa domesticus	I3LCH3 (AlphaFold model)
RNA polymerase II subunit D	D	protein	142	Sus scrofa domesticus	A0A4X1VM56 (AlphaFold model)
DNA-directed RNA polymerase II subunit E	E	protein	210	Sus scrofa domesticus	I3LSI7
DNA-directed RNA polymerases I, II, and III subunit RPABC2	F	protein	127	Sus scrofa domesticus	A0A4X1VEK9
DNA-directed RNA polymerase subunit	G	protein	172	Sus scrofa domesticus	A0A4X1VKG7
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	150	Sus scrofa domesticus	I3LCB2
DNA-directed RNA polymerase II subunit RPB9	I	protein	125	Sus scrofa domesticus	P60899
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	67	Sus scrofa domesticus	A0A4X1VYD0
DNA-directed RNA polymerase II subunit RPB11-a	K	protein	117	Sus scrofa domesticus	F1RKE4
RNA polymerase II, I and III subunit K	L	protein	58	Sus scrofa domesticus	A0A4X1TRS6

9 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>9HWG_1 DNA-directed RNA polymerase subunit (chains A)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Sequence of entity 2 (B), FASTA

>9HWG_2 DNA-directed RNA polymerase subunit beta (chains B)
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 3 (C), FASTA

>9HWG_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Sequence of entity 4 (D), FASTA

>9HWG_4 RNA polymerase II subunit D (chains D)
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY

Sequence of entity 5 (E), FASTA

>9HWG_5 DNA-directed RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 6 (F), FASTA

>9HWG_6 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD

Sequence of entity 7 (G), FASTA

>9HWG_7 DNA-directed RNA polymerase subunit (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Sequence of entity 8 (H), FASTA

>9HWG_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Sequence of entity 9 (I), FASTA

>9HWG_9 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Sequence of entity 10 (J), FASTA

>9HWG_10 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK

Sequence of entity 11 (K), FASTA

>9HWG_11 DNA-directed RNA polymerase II subunit RPB11-a (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Sequence of entity 12 (L), FASTA

>9HWG_12 RNA polymerase II, I and III subunit K (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ZN	Zinc ion	Zn	10

Primary citation

Structural basis of RECQL5-induced RNA polymerase II transcription braking and subsequent reactivation. Zhang, L., Gordiyenko, Y., Morgan, T. et al. Nat Struct Mol Biol (2025) 32:1731-1740. DOI 10.1038/s41594-025-01586-6 · PubMed

Other PDB entries of the same protein (UniProt A0A8D1DPV6), best resolution first:

9HVQ 2.0 Å, Structure of the transcribing Pol II-DSIF-PAF-SPT6-RECQL5 complex
7NVU 2.5 Å, RNA polymerase II core pre-initiation complex with open promoter DNA
8QEP 2.5 Å, RNA polymerase II bound to Alu RNA right arm
8B3D 2.6 Å, Structure of the Pol II-TCR-ELOF1 complex.
7OOB 2.7 Å, Pol II-CSB-CSA-DDB1-UVSSA-ADPBeF3 (Structure2)
8UHG 2.7 Å, Structure of paused transcription complex Pol II-DSIF-NELF - poised post-translocated
8UI0 2.7 Å, Structure of poised transcription complex Pol II-DSIF-NELF - pre-translocated
8WAV 2.72 Å, De novo transcribing complex 12 (TC12), the early elongation complex with Pol II…
8WAX 2.75 Å, De novo transcribing complex 14 (TC14), the early elongation complex with Pol II…
8WAZ 2.76 Å, De novo transcribing complex 16 (TC16), the early elongation complex with Pol II…
7F4G 2.78 Å, Structure of RPAP2-bound RNA polymerase II
8WAU 2.78 Å, De novo transcribing complex 11 (TC11), the early elongation complex with Pol II…

Browse structure collections

About this viewer

MolViewer shows 9HWG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.