9IUI: PSD-95 GK domain

Crystal structure of PSD-95 GK domain in complex with GK_FingR. Determined by X-ray diffraction at 1.93 Å resolution. Released 23 Jul 2025.

Method: X-ray diffraction
Resolution: 1.93 Å
Organisms: Rattus norvegicus, unclassified sequences
Chains: 4
Atoms: 4,667
Mol. weight: 64.98 kDa
Released: 23 Jul 2025

Explore 9IUI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9IUI contains 24 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	537-540	4	1
α-helix	544-554	11
β-strand	559-560	2	2
β-strand	565-566	2	3
α-helix	569-571	3
β-strand	576	1	4
β-strand	580	1	4
β-strand	581-582	2	3
α-helix	586-594	9
β-strand	598-604	7	3
β-strand	607-612	6	3
α-helix	613-620	8
β-strand	625-626	2	2
β-strand	627-628	2	1
α-helix	633-640	8
β-strand	646-650	5	1
α-helix	655-661	7
α-helix	667-684	18
α-helix	685-687	3
β-strand	690-692	3	1
α-helix	697-710	14

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	5
β-strand	11-15	5	5
β-strand	23-32	10	6
α-helix	38-39	2
β-strand	40-45	6	6
β-strand	50-53	4	5
α-helix	56-57	2
β-strand	62-70	9	6
α-helix	76-78	3
β-strand	82-86	5	6

Chain D: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	11
β-strand	12-16	5	11
β-strand	23-32	10	12
α-helix	38-39	2
β-strand	40-45	6	12
β-strand	50-53	4	11
α-helix	56-57	2
β-strand	61-70	10	12
α-helix	76-78	3
β-strand	82-87	6	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 4	A, C	protein	189	Rattus norvegicus	P31016 (AlphaFold model)
FingR targeting PSD-95	B, D	protein	96	unclassified sequences

Sequence of entity 1 (A, C), FASTA

>9IUI_1 Disks large homolog 4 (chains A, C)
GPGSEFVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVS
SREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLH
PIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKV
KRVIEDLSG

Sequence of entity 2 (B, D), FASTA

>9IUI_2 FingR targeting PSD-95 (chains B, D)
GPGSEFMLEVKEASPTSIQISWVLHLRHVRYYRITYGETGGNSPVQEFTVPGSKSTATIS
GLKPGVDYTITVYAVTIFSAYRSAWPPISINYRTGS

Primary citation

Modulating synaptic glutamate receptors by targeting network nodes of the postsynaptic density condensate. Jia, B., Zhu, S., Shen, Z. et al. Mol Cell (2025) 85:3166. DOI 10.1016/j.molcel.2025.07.017 · PubMed

Other PDB entries of the same protein (UniProt P31016 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HEY 1.5 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5MZ7 1.53 Å, Crystal Structure of the third PDZ domain from the synaptic protein PSD-95 with…
1TP5 1.54 Å, Crystal structure of PDZ3 domain of PSD-95 protein complexed with a peptide ligand KKETWV
5HFD 1.6 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant)
5HFB 1.62 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant) in complex with a…
5HEB 1.65 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a C-terminal…
5HED 1.7 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a mutant…
5HF1 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5HFF 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…
5HF4 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant)
1KJW 1.8 Å, SH3-Guanylate Kinase Module from PSD-95
5HFE 1.8 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…

Browse structure collections

About this viewer

MolViewer shows 9IUI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.