9IUN: Trim25 Pspry

Crystal structure of Trim25 Pspry. Determined by X-ray diffraction at 2.7 Å resolution. Released 30 Jul 2025.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 12
Atoms: 19,317
Mol. weight: 282.9 kDa
Released: 30 Jul 2025

Explore 9IUN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9IUN contains 65 α-helices and 205 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	6-13	8
α-helix	17-20	4
α-helix	21-23	3
β-strand	24	1	1
β-strand	29	1	2
β-strand	38-41	4	1
β-strand	46-49	4	1
α-helix	56-58	3
β-strand	68-70	3	3
β-strand	71	1	2
β-strand	75	1	3
β-strand	79-86	8	1
β-strand	90-98	9	3
α-helix	106-108	3
β-strand	116-123	8	3
β-strand	125-130	6	3
β-strand	133-137	5	3
β-strand	144-150	7	1
β-strand	155-161	7	1
β-strand	165-172	8	1
β-strand	179-185	7	3
β-strand	191-194	4	1
α-helix	195	1

Chain B: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	5-13	9
α-helix	17-20	4
α-helix	21-23	3
β-strand	24	1	4
β-strand	29	1	5
β-strand	38-41	4	4
β-strand	46-49	4	4
α-helix	56-58	3
β-strand	68-70	3	6
β-strand	71	1	5
β-strand	75	1	6
β-strand	79-86	8	4
β-strand	92-98	7	6
α-helix	106-108	3
β-strand	116-122	7	6
β-strand	125-130	6	6
β-strand	133-137	5	6
β-strand	144-150	7	4
β-strand	155-161	7	4
β-strand	165-172	8	4
β-strand	179-185	7	6
β-strand	191-194	4	4

Chain C: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	6-13	8
α-helix	17-20	4
α-helix	21-23	3
β-strand	24	1	7
β-strand	29	1	8
β-strand	38-41	4	7
β-strand	46-49	4	7
α-helix	56-58	3
β-strand	68-70	3	9
β-strand	71	1	8
β-strand	75	1	9
β-strand	79-86	8	7
β-strand	92-98	7	9
α-helix	106-108	3
β-strand	116-122	7	9
β-strand	125-130	6	9
β-strand	133-137	5	9
β-strand	144-150	7	7
β-strand	155-161	7	7
β-strand	165-172	8	7
α-helix	178	1
β-strand	179-185	7	9
β-strand	191-194	4	7

Chains D and J: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	7-13	7
α-helix	17-20	4
α-helix	21-23	3
β-strand	24	1	10
β-strand	29	1	11
β-strand	38-41	4	10
β-strand	46-49	4	10
α-helix	56-58	3
β-strand	68-70	3	12
β-strand	71	1	11
β-strand	75	1	12
β-strand	79-86	8	10
β-strand	91-98	8	12
α-helix	106-108	3
β-strand	116-122	7	12
β-strand	125-130	6	12
β-strand	133-137	5	12
β-strand	144-150	7	10
β-strand	155-161	7	10
β-strand	165-172	8	10
β-strand	179-185	7	12
β-strand	191-194	4	10

Chain E: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	6-13	8
α-helix	17-21	5
β-strand	24	1	13
β-strand	29	1	14
β-strand	38-41	4	13
β-strand	46-49	4	13
α-helix	56-58	3
β-strand	68-70	3	15
β-strand	71	1	14
β-strand	75	1	15
β-strand	79-86	8	13
β-strand	91-98	8	15
α-helix	106-108	3
β-strand	116-122	7	15
β-strand	127-130	4	15
β-strand	133-136	4	15
β-strand	144-150	7	13
β-strand	155-161	7	13
β-strand	165-172	8	13
α-helix	178	1
β-strand	179-185	7	15
β-strand	191-194	4	13

Chain F: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	7-13	7
α-helix	17-20	4
α-helix	21-23	3
β-strand	24	1	16
β-strand	29	1	17
β-strand	38-41	4	16
β-strand	46-49	4	16
α-helix	56-58	3
β-strand	68-70	3	18
β-strand	71	1	17
β-strand	75	1	18
β-strand	79-86	8	16
β-strand	90-98	9	18
α-helix	106-108	3
β-strand	116-123	8	18
β-strand	125-130	6	18
β-strand	133-137	5	18
β-strand	144-150	7	16
β-strand	155-161	7	16
β-strand	165-172	8	16
β-strand	179-185	7	18
β-strand	191-194	4	16

Chain G: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	7-14	8
α-helix	17-20	4
α-helix	21-23	3
β-strand	24	1	19
β-strand	29	1	20
β-strand	38-41	4	19
β-strand	46-49	4	19
α-helix	56-58	3
β-strand	68-70	3	21
β-strand	71	1	20
β-strand	75	1	21
β-strand	79-86	8	19
β-strand	90-98	9	21
α-helix	106-108	3
β-strand	116-123	8	21
β-strand	125-130	6	21
β-strand	133-137	5	21
β-strand	144-150	7	19
β-strand	155-161	7	19
β-strand	165-172	8	19
β-strand	179-185	7	21
β-strand	191-194	4	19

Chain H: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	4-13	10
α-helix	17-20	4
α-helix	21-23	3
β-strand	24	1	22
β-strand	29	1	23
β-strand	38-41	4	22
β-strand	46-49	4	22
α-helix	56-58	3
β-strand	68-70	3	24
β-strand	71	1	23
β-strand	75	1	24
β-strand	79-86	8	22
β-strand	92-98	7	24
α-helix	106-108	3
β-strand	116-122	7	24
β-strand	125-130	6	24
β-strand	133-137	5	24
β-strand	144-150	7	22
β-strand	155-161	7	22
β-strand	165-172	8	22
α-helix	178	1
β-strand	179-185	7	24
β-strand	191-194	4	22

3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin/ISG15 ligase TRIM25	A, B, C, D, E, F, G, H, I, J, K, L	protein	205	Homo sapiens	Q14258 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L), FASTA

>9IUN_1 E3 ubiquitin/ISG15 ligase TRIM25 (chains A, B, C, D, E, F, G, H, I, J, K, L)
MSTSLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYTVASVAEMPQNYRPH
PQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPESRLGRNSASWCV
EWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLMYKFRVDFTEAL
YPAFWVFSAGATLSICSPKYLEHHH

Primary citation

The structural basis of TRIM25-mediated regulation of RIG-I. Li, Y., Wu, S., Tian, X. et al. J Biol Chem (2025) 301:108367-108367. DOI 10.1016/j.jbc.2025.108367 · PubMed

Other PDB entries of the same protein (UniProt Q14258 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9I0T 1.8 Å, Crystal structure of TRIM25 PRYSPRY covalently bound to…
6FLM 2.01 Å, Crystal structure of the human TRIM25 PRYSPRY domain
5FER 2.34 Å, Complex of TRIM25 RING with UbcH5-Ub
5EYA 2.4 Å, TRIM25 RING domain in complex with Ubc13-Ub conjugate
4LTB 2.59 Å, Coiled-coil domain of TRIM25
4CFG 2.8 Å, Structure of the TRIM25 coiled-coil
5NT1 2.82 Å, Complex of influenza A NS1 effector domain with TRIM25 coiled coil
6FLN 3.6 Å, Crystal structure of the human TRIM25 coiled-coil and PRYSPRY domains
5NT2 4.26 Å, Complex of influenza A NS1 with TRIM25 coiled coil domain

Browse structure collections

About this viewer

MolViewer shows 9IUN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.