9J5E: Hir2_WD40

Name: PDB 9J5E: Crystal structure of Hir2_WD40 in complex with Hpc2_NHRD
Published: 2025-06-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of Hir2_WD40 in complex with Hpc2_NHRD. Determined by X-ray diffraction at 1.9 Å resolution. Released 11 Jun 2025.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 2
Atoms: 3,056
Mol. weight: 44.31 kDa
Released: 11 Jun 2025

Explore 9J5E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9J5E contains 9 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	15-21	7	2
β-strand	24-29	6	2
α-helix	30-32	3
β-strand	33-38	6	2
α-helix	39-46	8
α-helix	52-54	3
β-strand	59-62	4	2
β-strand	71-76	6	3
β-strand	80-85	6	3
β-strand	88-93	6	3
β-strand	96-97	2	4
β-strand	102-103	2	4
α-helix	104-105	2
α-helix	106-108	3
β-strand	110-116	7	3
β-strand	123-129	7	5
β-strand	134-139	6	5
β-strand	144-149	6	5
β-strand	155-160	6	5
β-strand	167-172	6	6
β-strand	178-183	6	6
β-strand	188-193	6	6
β-strand	199-205	7	6
β-strand	209	1	7
β-strand	217-218	2	8
β-strand	226-232	7	7
β-strand	243-248	6	7
β-strand	254-260	7	7
α-helix	263-264	2
β-strand	269-270	2	8
β-strand	271-272	2	9
β-strand	277-281	5	10
β-strand	286-290	5	10
β-strand	292-295	4	9
β-strand	302-303	2	11
β-strand	304-307	4	9
β-strand	312-313	2	9
β-strand	318-319	2	11
β-strand	325-330	6	1
β-strand	336-341	6	1
β-strand	345-350	6	1
α-helix	353-356	4
β-strand	358-359	2	10
α-helix	360-361	2
α-helix	362-369	8

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	452-455	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein HIR2	A	protein	373	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P32480 (AlphaFold model)
Peptide from Histone promoter control protein 2	B	protein	21	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	Q01448 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9J5E_1 Protein HIR2 (chains A)
MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS
FQVDQDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFECKSP
STITDVKYDINLGILFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGIIDPTGQTFT
VMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVPNNA
TSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATSGSTD
GTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLGVAL
PQTEIKSLQEVNK

Sequence of entity 2 (B), FASTA

>9J5E_2 Peptide from Histone promoter control protein 2 (chains B)
KEPSILIDVPLYQADTNDYLD

Primary citation

Structural insights into the interaction of Hir2 and Hpc2 in the yeast Hir histone chaperone complex. Tseng, C.H., Hsieh, W.L., Chiang, W.T. et al. Structure (2025) 33:1408-1416.e3. DOI 10.1016/j.str.2025.05.003 · PubMed

Other PDB entries of the same protein (UniProt P32480 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8GHL 2.96 Å, the Hir complex core
8GHN 2.96 Å, Composite model of the yeast Hir Complex with Asf1/H3/H4
8GHA 6.8 Å, Hir3 Arm/Tail, Hir2 WD40, C-terminal Hpc2

Browse structure collections

About this viewer

MolViewer shows 9J5E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.