9JE5: Human TRPV3

Cryo-EM structure of human TRPV3 in complex with citronellal determined in MSP2N2 nanodisc. Determined by electron microscopy at 3.53 Å resolution. Released 26 Mar 2025.

Method: Electron microscopy
Resolution: 3.53 Å
Organism: Homo sapiens
Chains: 4
Atoms: 20,824
Mol. weight: 382.81 kDa
Ligands: A1EBV, POV
Released: 26 Mar 2025

Explore 9JE5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9JE5 contains 140 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 35 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	121-129	9
α-helix	132-143	12
α-helix	171-175	5
α-helix	184-194	11
α-helix	200-204	5
β-strand	209	1	1
β-strand	214	1	1
α-helix	218-224	7
α-helix	228-237	10
α-helix	265-267	3
α-helix	268-271	4
α-helix	275-282	8
α-helix	299-306	8
α-helix	316-328	13
α-helix	344-350	7
α-helix	354-361	8
β-strand	376-382	7	2
β-strand	385-392	8	2
α-helix	403-408	6
α-helix	416-419	4
α-helix	423-432	10
α-helix	433-437	5
α-helix	438-453	16
α-helix	456-459	4
α-helix	489-507	19
α-helix	520-540	21
α-helix	551-560	10
α-helix	561-563	3
α-helix	570-582	13
α-helix	583-587	5
α-helix	588-598	11
α-helix	602-608	7
β-strand	609	1	3
α-helix	625-637	13
β-strand	648	1	3
α-helix	651-664	14
α-helix	665-669	5
α-helix	670-684	15
α-helix	688-705	18
α-helix	710-713	4
β-strand	718	1	2
β-strand	730-737	8	2
α-helix	739-746	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transient receptor potential cation channel subfamily V member 3	A, B, C, D	protein	799	Homo sapiens	Q8NET8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>9JE5_1 Transient receptor potential cation channel subfamily V member 3 (chains A, B, C, D)
MKAHPKEMVPLMGKRVAAPSGNPAVLPEKRPAEITPTKKSAHFFLEIEGFEPNPTVAKTS
PPVFSKPMDSNIRQCISGNCDDMDSPQSPQDDVTETPSNPNSPSAQLAKEEQRRKKRRLK
KRIFAAVSEGCVEELVELLVELQELCRRRHDEDVPDFLMHKLTASDTGKTCLMKALLNIN
PNTKEIVRILLAFAEENDILGRFINAEYTEEAYEGQTALNIAIERRQGDIAALLIAAGAD
VNAHAKGAFFNPKYQHEGFYFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNIL
HALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETTRNNDGLTPLQLAAKMGKAEILKYI
LSREIKEKRLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDNSVLEITVYNTNIDNRHEML
TLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMG
WLQLLGRMFVLIWAMCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFIQAVLVILSVFLY
LFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFLLG
FGVALASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSKYPILFLFLLIT
YVILTFVLLLNMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGEL
CKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFE
EVEEFPETSVSNSLEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
A1EBV	(3~{S})-3,7-dimethyloct-6-enal	C10 H18 O	4
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	20

Primary citation

Plant essential oil targets TRPV3 for skin renewal and structural mechanism of action. Li, Y., Lu, X., Cheng, X. et al. Nat Commun (2025) 16:2728-2728. DOI 10.1038/s41467-025-58033-9 · PubMed

Other PDB entries of the same protein (UniProt Q8NET8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6H9J 1.83 Å, Factor Inhibiting HIF (FIH) in complex with zinc, NOG and TRPV3 (229-255)
6HA6 1.98 Å, Factor Inhibiting HIF (FIH) in complex with zinc, NOG and TRPV3 (220-246)
7QQN 2.45 Å, The PDZ domain of SNTG1 complexed with the acetylated PDZ-binding motif of TRPV3
8V6K 2.46 Å, Apo-state cryo-EM structure of human TRPV3 in cNW30 nanodiscs
13LU 2.49 Å, Structure of human TRPV3-W521S Olmsted syndrome mutant in the closed state
7XJ0 2.53 Å, Structure of human TRPV3 in complex with Trpvicin
8GKA 2.55 Å, Human TRPV3 tetramer structure, closed conformation
8V6N 2.59 Å, Open-state cryo-EM structure of human TRPV3 in presence of 2-APB in cNW30 nanodiscs
9PJ5 2.76 Å, Closed-state structure of wild-type human TRPV3 purified in GDN detergent
8V6O 2.83 Å, Inactivated-state cryo-EM structure of human TRPV3 in presence of 2-APB in cNW30 nanodiscs
13LJ 2.86 Å, Structure of human TRPV3-G568C Olmsted syndrome mutant in the closed state
7XJ1 2.93 Å, Structure of human TRPV3_G573S in complex with Trpvicin in C2 symmetry

Browse structure collections

About this viewer

MolViewer shows 9JE5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.