9JEA: M1 muscarinic acetylcholine receptor

cryo-EM structure of M1 muscarinic acetylcholine receptor in complex with atropine. Determined by electron microscopy at 3.4 Å resolution. Released 9 Jul 2025.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,745
Mol. weight: 52.12 kDa
Ligands: A1EBT
Released: 9 Jul 2025

Explore 9JEA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9JEA contains 23 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 0 β-strands

Element	Residues	Length
α-helix	27-43	17
α-helix	59-73	15
α-helix	74-78	5
α-helix	79-85	7
α-helix	96-128	33
α-helix	143-162	20
α-helix	181-183	3
α-helix	186-193	8
α-helix	194-198	5
α-helix	199-227	29
α-helix	233-245	13
α-helix	251-263	13
α-helix	276-280	5
α-helix	287-293	7
α-helix	306-319	14
α-helix	321-323	3
α-helix	324-332	9
α-helix	338-349	12
α-helix	359-393	35
α-helix	406-413	8
α-helix	414-416	3
α-helix	418-424	7
α-helix	425-427	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Muscarinic acetylcholine receptor M1,de novo design protein	A	protein	466	Homo sapiens	P11229 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9JEA_1 Muscarinic acetylcholine receptor M1,de novo design protein (chains A)
DYKDDDAMNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVN
TKLKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASV
MNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTV
LAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRFRRRGAEALERAFSLEDDKE
ALLAALDALAEAFADDAELTALLALLRRLLEDPDLPADELAALRAALTRFPEFREALLAL
LDRYLATRDLADARDLVWALVLAIASDPRYRPAVAAMIAFGDAEVLRAGLLRGAEALGLP
GGEALVEEIMAEAEKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGY
WLCYVNSTININPMCYALCNINPMCYALCNINPMCYALCNHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
A1EBT	[(1R,5S)-8-methyl-8-azabicyclo[3.2.1]octan-3-yl] (2S)-3-oxidanyl-2-phenyl-propa…	C17 H23 N O3	1

Primary citation

cryo-EM structure of M1 muscarinic acetylcholine receptor in complex with atropine. Gao, K., Zhang, X. To be published.

Other PDB entries of the same protein (UniProt P11229 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZFZ 2.17 Å, Structure of M1-StaR-T4L in complex with 77-LH-28-1 at 2.17A
6ZG4 2.33 Å, Structure of M1-StaR-T4L in complex with HTL0009936 at 2.35A
6ZG9 2.5 Å, Structure of M1-StaR-T4L in complex with GSK1034702 at 2.5A
6WJC 2.55 Å, Muscarinic acetylcholine receptor 1 - muscarinic toxin 7 complex
5CXV 2.7 Å, Structure of the human M1 muscarinic acetylcholine receptor bound to antagonist Tiotropium
6OIJ 3.3 Å, Muscarinic acetylcholine receptor 1-G11 protein complex

Browse structure collections

About this viewer

MolViewer shows 9JEA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.