5CXV: Human M1 muscarinic acetylcholine receptor

Structure of the human M1 muscarinic acetylcholine receptor bound to antagonist Tiotropium. Determined by X-ray diffraction at 2.7 Å resolution. Released 9 Mar 2016.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 2
Atoms: 3,599
Mol. weight: 60.85 kDa
Ligands: Y01, 0HK
Released: 9 Mar 2016

Explore 5CXV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CXV contains 25 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	22-52	31
α-helix	54-56	3
α-helix	59-73	15
α-helix	74-78	5
α-helix	79-88	10
α-helix	95-128	34
α-helix	134-136	3
α-helix	139-168	30
α-helix	174	1
α-helix	186-193	8
α-helix	194-198	5
α-helix	199-212	14
α-helix	215-1010	14
β-strand	1013-1014	2	1
β-strand	1015	1	2
β-strand	1016-1018	3	1
β-strand	1024-1027	4	1
β-strand	1030-1033	4	1
α-helix	1038-1049	12
β-strand	1056	1	2
α-helix	1059-1079	21
α-helix	1083-1089	7
α-helix	1092-1111	20
α-helix	1114-1121	8
α-helix	1125-1132	8
α-helix	1136-1140	5
α-helix	1142-1154	13
α-helix	358-390	33
α-helix	397-406	10
α-helix	409-421	13
α-helix	425-433	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1	A	protein	515	Homo sapiens, Enterobacteria phage T4	P00720, P11229 (AlphaFold model)
FLAG peptide	C	protein	7	Enterobacteria phage T4

Sequence of entity 1 (A), FASTA

>5CXV_1 Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1 (chains A)
MKTIIALSYIFCLVFADYKDDDDAAAQTSAPPAVSPQITVLAPGKGPWQVAFIGITTGLL
SLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGT
LACDLWLALDYVASQASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFV
LWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRET
ENRNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVI
TKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSL
RMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYFSLVKEKKAARTLSAIL
LAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRL
LLLCRWDKRRWRKIPKRPGSVHRTPSRQCHHHHHH

Sequence of entity 2 (C), FASTA

>5CXV_2 FLAG peptide (chains C)
DYKDDDD

Ligands and cofactors

ID	Name	Formula	Copies
Y01	Cholesterol hemisuccinate	C31 H50 O4	1
0HK	(1R,2R,4S,5S,7S)-7-{[hydroxy(dithiophen-2-yl)acetyl]oxy}-9,9-dimethyl-3-oxa-9-a…	C19 H22 N O4 S2	1

Water and common crystallization additives (GOL, PGE, EDO) are not listed.

Primary citation

Crystal structures of the M1 and M4 muscarinic acetylcholine receptors. Thal, D.M., Sun, B., Feng, D. et al. Nature (2016) 531:335-340. DOI 10.1038/nature17188 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 5CXV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.