6ZG9: M1-StaR-T4L

Structure of M1-StaR-T4L in complex with GSK1034702 at 2.5A. Determined by X-ray diffraction at 2.5 Å resolution. Released 6 Oct 2021.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 1
Atoms: 3,741
Mol. weight: 54.19 kDa
Ligands: PO4, OLA, QK2
Released: 6 Oct 2021

Explore 6ZG9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ZG9 contains 25 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	22-52	31
α-helix	59-73	15
α-helix	74-78	5
α-helix	79-88	10
α-helix	95-128	34
α-helix	133-136	4
α-helix	139-168	30
α-helix	174	1
α-helix	186-193	8
α-helix	194-198	5
α-helix	199-218	20
α-helix	1003-1010	8
β-strand	1014-1015	2	1
β-strand	1016	1	2
β-strand	1017-1019	3	1
β-strand	1025-1028	4	1
β-strand	1031-1034	4	1
α-helix	1039-1050	12
β-strand	1057	1	2
α-helix	1060-1080	21
α-helix	1085-1090	6
α-helix	1093-1105	13
α-helix	1108-1112	5
α-helix	1115-1121	7
α-helix	1126-1134	9
α-helix	1137-1141	5
α-helix	1143-1155	13
α-helix	355-358	4
α-helix	362-390	29
α-helix	397-421	25
α-helix	423-437	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1	A	protein	455	Homo sapiens, Enterobacteria phage T4	P00720, P11229 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ZG9_1 Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1 (chains A)
METVEMVAIATVAGLLSLATVTGNILLMLSIKVNRQLQTVNNYFAFSLACADLIIGAFSM
NLYTVYIIMGHWALGALACDLALALDYVASNAAVMNLLLISFDRYFSVTRPLSYRAKRTP
RRALLMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMATFYL
PVTVMCTLYWRIYRETENRANIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNA
AKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALIN
MVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAY
TFSLVKEKAALRTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNATI
NPMCYALCNKAFRDTFRLLLLARWDHHHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1
OLA	Oleic acid	C18 H34 O2	6
QK2	7-fluoranyl-5-methyl-3-[1-(oxan-4-yl)piperidin-4-yl]-1~{H}-benzimidazol-2-one	C18 H24 F N3 O2	1

Water and common crystallization additives (EPE) are not listed.

Primary citation

From structure to clinic: Design of a muscarinic M1 receptor agonist with potential to treatment of Alzheimer's disease. Brown, A.J.H., Bradley, S.J., Marshall, F.H. et al. Cell (2021) 184:5886. DOI 10.1016/j.cell.2021.11.001 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 6ZG9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.