Killer immunoglobulin receptor KIR2DL2 in complex with KIR2DL2_KIR2DL2/3 agonist 61-scFv. Determined by X-ray diffraction at 3.4 Å resolution. Released 15 Oct 2025.
Explore 9LRH in 3D Show helices and sheets RCSB PDB PDBe
9LRH contains 11 α-helices and 50 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 7 |
| α-helix | 7-9 | 3 | |
| β-strand | 10-12 | 3 | 8 |
| β-strand | 18-25 | 8 | 7 |
| β-strand | 34-40 | 7 | 8 |
| β-strand | 43-51 | 9 | 8 |
| β-strand | 58-60 | 3 | 8 |
| β-strand | 68-73 | 6 | 7 |
| β-strand | 78-83 | 6 | 7 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-101 | 10 | 8 |
| β-strand | 104 | 1 | 1 |
| β-strand | 107-113 | 7 | 8 |
| β-strand | 114 | 1 | 7 |
| β-strand | 117-121 | 5 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 27-29 | 3 | |
| β-strand | 30-34 | 5 | 1 |
| β-strand | 38-40 | 3 | 2 |
| β-strand | 45-51 | 7 | 1 |
| β-strand | 57-63 | 7 | 3 |
| β-strand | 69-73 | 5 | 3 |
| α-helix | 74 | 1 | |
| β-strand | 75-77 | 3 | 1 |
| β-strand | 80-87 | 8 | 1 |
| α-helix | 92-94 | 3 | |
| β-strand | 96-103 | 8 | 3 |
| β-strand | 111 | 1 | 3 |
| α-helix | 113-117 | 5 | |
| β-strand | 118-120 | 3 | 3 |
| β-strand | 121-126 | 6 | 2 |
| β-strand | 130-134 | 5 | 4 |
| β-strand | 138-140 | 3 | 5 |
| β-strand | 144-151 | 8 | 4 |
| β-strand | 157-162 | 6 | 6 |
| β-strand | 168-171 | 4 | 6 |
| α-helix | 172-173 | 2 | |
| β-strand | 181-189 | 9 | 4 |
| β-strand | 194-201 | 8 | 6 |
| β-strand | 208 | 1 | 2 |
| β-strand | 209 | 1 | 6 |
| β-strand | 210 | 1 | 2 |
| α-helix | 211-215 | 5 | |
| β-strand | 216-218 | 3 | 6 |
| β-strand | 219-221 | 3 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | -6 | 1 | 9 |
| β-strand | -1 | 1 | 9 |
| β-strand | 4-7 | 4 | 10 |
| β-strand | 10-13 | 4 | 11 |
| β-strand | 19-25 | 7 | 10 |
| β-strand | 33-38 | 6 | 11 |
| α-helix | 43-44 | 2 | |
| β-strand | 45-49 | 5 | 11 |
| β-strand | 53-54 | 2 | 11 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 10 |
| β-strand | 70-75 | 6 | 10 |
| α-helix | 80-82 | 3 | |
| β-strand | 85-90 | 6 | 11 |
| β-strand | 97 | 1 | 8 |
| β-strand | 98 | 1 | 11 |
| β-strand | 102-106 | 5 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Killer cell immunoglobulin-like receptor 2DL2 | K | protein | 210 | Homo sapiens | P43627 (AlphaFold model) |
| KIR2DL2_KIR2DL2/3 agonist 61 scFV | H, L | protein | 253 | Homo sapiens |
>9LRH_1 Killer cell immunoglobulin-like receptor 2DL2 (chains K) HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVS KANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLA GESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGS FRDSPYEWSNSSDPLLVSVIGNPSHHHHHH
>9LRH_2 KIR2DL2_KIR2DL2/3 agonist 61 scFV (chains H, L) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSFAISWVRQAPGQGLEWMGGIIPIFGTANY AQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARVSGTTGGYYYGMDVWGQGTLVT VSSGGGGSGGGGSGGGGSAIRMTQSPSSVSASVGDRVTITCRASQGIGNWLAWYQQKPGR APKLLISTASSLQSGVPSRFSGGGSGRGFTLTISSLQLEDFATYYCQQSYITPWTFGQGT KVEIKGALEVLFQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Selective agonists of KIR and NKG2A to evade missing self response of natural killer cells. Hiura, S., Kuwasaki, Y., Nishikawa, Y. et al. Sci Rep (2025) 15:33550-33550. DOI 10.1038/s41598-025-18394-z · PubMed
Other PDB entries of the same protein (UniProt P43627 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9LRH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.