9LXF: Extended DNA-free MCM DH

Structure of extended DNA-free MCM DH at 3.8 Angstroms resolution. Determined by electron microscopy at 3.86 Å resolution. Released 18 Feb 2026.

Method: Electron microscopy
Resolution: 3.86 Å
Organism: Homo sapiens
Chains: 14
Atoms: 66,032
Mol. weight: 1297.92 kDa
Ligands: ADP, ATP
Released: 18 Feb 2026

Explore 9LXF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LXF contains 357 α-helices and 354 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains 2 and D: 32 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	185-187	3
α-helix	189-204	16
α-helix	214-223	10
β-strand	229-233	5	1
α-helix	235-240	6
α-helix	244-247	4
α-helix	252-270	19
α-helix	274-276	3
β-strand	282-286	5	1
β-strand	291-292	2	2
α-helix	294-296	3
α-helix	299-301	3
β-strand	302	1	2
β-strand	305-316	12	2
β-strand	374-379	6	2
α-helix	391-392	2
β-strand	393-398	6	2
β-strand	411-419	9	2
β-strand	438-445	8	2
α-helix	461-469	9
α-helix	473-478	6
α-helix	489-500	12
β-strand	505	1	3
β-strand	513	1	3
β-strand	519-523	5	4
α-helix	529-539	11
β-strand	543-547	5	4
β-strand	559-562	4	2
β-strand	569-572	4	2
α-helix	575-578	4
β-strand	583-587	5	4
α-helix	589-591	3
α-helix	594-606	13
β-strand	608-612	5	5
β-strand	617-621	5	5
β-strand	625-630	6	4
α-helix	633-635	3
α-helix	643-647	5
α-helix	651-655	5
β-strand	659-663	5	4
α-helix	671-685	15
α-helix	713-716	4
α-helix	717-727	11
α-helix	741-756	16
α-helix	759-762	4
α-helix	764-781	18
α-helix	788-802	15
α-helix	808-818	11
α-helix	819-821	3
α-helix	828-851	24
β-strand	858-861	4	6
α-helix	863-872	10
α-helix	878-882	5
β-strand	891-894	4	6
β-strand	899-902	4	6

Chain 3: 21 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	14-22	9
α-helix	32-42	11
β-strand	47-50	4	7
α-helix	51-57	7
α-helix	62-65	4
α-helix	73-82	10
β-strand	100-103	4	7
β-strand	124	1	8
β-strand	127-130	4	9
β-strand	131	1	10
β-strand	133-135	3	11
β-strand	140-147	8	12
β-strand	156-158	3	12
β-strand	177	1	13
β-strand	183	1	13
β-strand	185-194	10	12
β-strand	201	1	10
β-strand	234-237	4	9
α-helix	239	1
β-strand	240	1	8
α-helix	241	1
β-strand	261	1	8
α-helix	281-288	8
α-helix	296-301	6
α-helix	311-322	12
β-strand	327-328	2	14
β-strand	334-335	2	14
β-strand	341-345	5	15
α-helix	352-361	10
β-strand	365-369	5	15
β-strand	382-384	3	11
β-strand	391-394	4	11
α-helix	397-400	4
β-strand	405-409	5	15
α-helix	416-427	12
β-strand	430-434	5	16
β-strand	439-443	5	16
β-strand	447-452	6	15
α-helix	453-454	2
α-helix	473-478	6
β-strand	481-485	5	15
α-helix	491-504	14
α-helix	567-575	9
β-strand	581-582	2	17
α-helix	584-597	14
α-helix	600-603	4
α-helix	615-631	17
β-strand	636-637	2	17
α-helix	639-653	15

Chains 4 and F: 26 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	162-171	10
α-helix	192-201	10
β-strand	207-208	2	18
β-strand	211	1	19
α-helix	214-218	5
α-helix	220-228	9
α-helix	230-248	19
β-strand	259-260	2	18
β-strand	263	1	19
α-helix	276-278	3
β-strand	282-292	11	20
β-strand	296-306	11	21
β-strand	312-316	5	21
β-strand	323	1	22
β-strand	337-339	3	21
β-strand	345-349	5	21
β-strand	350-355	6	20
α-helix	366-368	3
β-strand	371-374	4	20
β-strand	387-397	11	20
β-strand	400	1	23
β-strand	408-409	2	23
β-strand	411	1	24
β-strand	413-422	10	20
α-helix	434-441	8
α-helix	445-453	9
α-helix	459-465	7
α-helix	474-485	12
β-strand	506-510	5	25
α-helix	517-526	10
β-strand	531-534	4	25
β-strand	545-549	5	26
β-strand	556-560	5	26
α-helix	562-566	5
β-strand	570-574	5	25
α-helix	581-593	13
β-strand	595-600	6	27
β-strand	603-608	6	27
β-strand	612-617	6	25
α-helix	620-622	3
α-helix	630-634	5
α-helix	638-641	4
β-strand	646-650	5	25
α-helix	656-671	16
α-helix	684-697	14
β-strand	701-702	2	28
α-helix	704-720	17
α-helix	731-747	17
β-strand	752-753	2	28
α-helix	755-772	18
β-strand	774	1	29
β-strand	781	1	29
α-helix	784-787	4
α-helix	792-812	21
β-strand	818	1	30
α-helix	820-830	11
α-helix	837-849	13
β-strand	854-856	3	30
β-strand	859-861	3	30

Chain 5: 30 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	31
α-helix	28-41	14
β-strand	44	1	32
β-strand	52	1	32
α-helix	54-65	12
β-strand	69-73	5	33
α-helix	74-80	7
α-helix	82-90	9
α-helix	96-111	16
α-helix	112	1
α-helix	114	1
α-helix	121-122	2
β-strand	125-129	5	33
α-helix	137-139	3
α-helix	142-144	3
β-strand	148	1	34
β-strand	151-159	9	34
β-strand	162-172	11	35
β-strand	179-183	5	35
β-strand	212-224	13	35
β-strand	228-230	3	34
α-helix	242-243	2
β-strand	244-248	5	34
β-strand	262-271	10	34
β-strand	292-301	10	34
α-helix	306-310	5
α-helix	316-325	10
α-helix	331-334	4
α-helix	347-351	5
α-helix	352-356	5
β-strand	378	1	36
α-helix	388-397	10
β-strand	401-405	5	36
β-strand	417-420	4	34
β-strand	427-430	4	34
α-helix	433-436	4
β-strand	441-445	5	36
α-helix	447-449	3
α-helix	457-463	7
β-strand	466-467	2	37
α-helix	471-473	3
β-strand	478-479	2	37
β-strand	483-487	5	36
α-helix	510-513	4
α-helix	556-567	12
β-strand	573-574	2	38
α-helix	576-595	20
α-helix	610-626	17
β-strand	631-632	2	38
α-helix	634-644	11
α-helix	645-649	5
α-helix	669-682	14
α-helix	691-700	10
α-helix	705-718	14
β-strand	721-724	4	39
β-strand	729-732	4	39

Chains 6 and G: 33 helices, 34 β-strands

Element	Residues	Length	Sheet
α-helix	16-19	4
α-helix	21-36	16
β-strand	39-40	2	40
β-strand	42	1	40
α-helix	45-52	8
β-strand	60-64	5	41
α-helix	65-71	7
α-helix	73-81	9
α-helix	83-98	16
β-strand	111-115	5	41
β-strand	121	1	42
α-helix	123-125	3
α-helix	128-130	3
β-strand	131	1	43
β-strand	134-136	3	43
β-strand	137	1	42
β-strand	140-144	5	43
α-helix	145-147	3
β-strand	148-150	3	44
β-strand	153-158	6	45
β-strand	164-169	6	45
β-strand	191-193	3	45
β-strand	201-203	3	44
β-strand	204-209	6	43
β-strand	224-228	5	43
α-helix	231-234	4
β-strand	242	1	46
β-strand	245-253	9	43
β-strand	288	1	22
β-strand	293-302	10	43
β-strand	305	1	46
α-helix	306-307	2
α-helix	322-327	6
α-helix	331-342	12
α-helix	346-354	9
α-helix	362-373	12
β-strand	378-379	2	47
β-strand	385-386	2	47
β-strand	392-395	4	48
α-helix	402-412	11
β-strand	416-420	5	48
β-strand	431-435	5	43
β-strand	442-446	5	43
α-helix	450-452	3
β-strand	456-460	5	48
α-helix	462-464	3
α-helix	467-479	13
β-strand	481-485	5	49
β-strand	490-494	5	49
β-strand	498-503	6	48
α-helix	504-505	2
α-helix	510-511	2
α-helix	516-519	4
α-helix	524-527	4
β-strand	533-535	3	48
α-helix	542-557	16
α-helix	569-579	11
α-helix	588-604	17
β-strand	612	1	50
α-helix	619-634	16
α-helix	642-655	14
β-strand	658	1	50
α-helix	721-733	13
α-helix	735-738	4
α-helix	745-755	11
α-helix	756-758	3
α-helix	763-781	19

Chain 7: 33 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
α-helix	34-41	8
β-strand	47-51	5	51
α-helix	52-56	5
α-helix	60-68	9
α-helix	70-84	15
α-helix	85-88	4
α-helix	98-112	15
β-strand	135-139	5	51
α-helix	140-141	2
β-strand	147	1	24
α-helix	154-156	3
β-strand	160-170	11	24
α-helix	171-173	3
β-strand	174-184	11	24
β-strand	191-194	4	24
β-strand	199-200	2	23
α-helix	201-203	3
β-strand	205	1	52
α-helix	209-213	5
β-strand	219	1	52
β-strand	220-238	19	24
α-helix	245	1
α-helix	249-251	3
β-strand	253-258	6	24
α-helix	259-261	3
β-strand	270-280	11	24
β-strand	287	1	12
β-strand	292-293	2	12
β-strand	295-302	8	24
α-helix	321-326	6
α-helix	332-339	8
α-helix	348-359	12
β-strand	377-378	2	53
β-strand	381	1	54
α-helix	390-397	8
β-strand	401-404	4	53
β-strand	416	1	55
β-strand	419-421	3	56
β-strand	426-428	3	56
β-strand	431	1	55
α-helix	434-436	3
β-strand	441-444	4	53
α-helix	447-449	3
α-helix	452-463	12
β-strand	466-471	6	57
β-strand	474-479	6	57
β-strand	483-486	4	53
α-helix	495-496	2
α-helix	509-512	4
β-strand	517-518	2	53
β-strand	521	1	54
α-helix	531-543	13
α-helix	546-548	3
α-helix	552-555	4
α-helix	556-565	10
β-strand	572	1	58
α-helix	575-577	3
α-helix	578-594	17
α-helix	603-619	17
β-strand	624	1	58
α-helix	627-644	18
α-helix	647-649	3

Chain A: 32 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
α-helix	34-41	8
β-strand	47-51	5	59
α-helix	52-56	5
α-helix	60-68	9
α-helix	70-84	15
α-helix	85-88	4
α-helix	98-112	15
β-strand	135-139	5	59
α-helix	140-141	2
β-strand	147	1	31
α-helix	154-156	3
β-strand	160-170	11	31
α-helix	171-173	3
β-strand	174-184	11	31
β-strand	191-194	4	31
β-strand	199-200	2	60
α-helix	201-203	3
β-strand	205	1	61
α-helix	209-213	5
β-strand	219	1	61
β-strand	220-238	19	31
α-helix	245	1
α-helix	249-251	3
β-strand	253-258	6	31
α-helix	259-261	3
β-strand	270-280	11	31
β-strand	287	1	62
β-strand	292-293	2	62
β-strand	295-302	8	31
α-helix	321-326	6
α-helix	332-339	8
α-helix	348-359	12
β-strand	377-378	2	63
β-strand	381	1	64
α-helix	390-397	8
β-strand	401-404	4	63
β-strand	416	1	65
β-strand	419-421	3	66
β-strand	426-428	3	66
β-strand	431	1	65
α-helix	434-436	3
β-strand	441-444	4	63
α-helix	447-449	3
α-helix	452-463	12
β-strand	466-471	6	67
β-strand	474-479	6	67
β-strand	483-486	4	63
α-helix	495-496	2
α-helix	509-512	4
β-strand	517-518	2	63
β-strand	521	1	64
α-helix	531-543	13
α-helix	546-548	3
α-helix	552-555	4
α-helix	556-565	10
β-strand	572	1	68
α-helix	575-577	3
α-helix	578-594	17
α-helix	603-619	17
β-strand	624	1	68
α-helix	627-644	18

Chains B and C: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	741-758	18
β-strand	762-764	3	69
α-helix	765-774	10
α-helix	779-781	3
α-helix	782-794	13
β-strand	798-800	3	69
β-strand	804-807	4	69

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA replication licensing factor MCM2	2, D	protein	904	Homo sapiens	P49736 (AlphaFold model)
Isoform 2 of DNA replication licensing factor MCM3	3, B, C, E	protein	853	Homo sapiens	P25205 (AlphaFold model)
DNA replication licensing factor MCM4	4, F	protein	863	Homo sapiens	P33991 (AlphaFold model)
DNA replication licensing factor MCM5	5, H	protein	734	Homo sapiens	P33992 (AlphaFold model)
DNA replication licensing factor MCM6	6, G	protein	821	Homo sapiens	Q14566
DNA replication licensing factor MCM7	7, A	protein	719	Homo sapiens	P33993

Sequence of entity 1 (2, D), FASTA

>9LXF_1 DNA replication licensing factor MCM2 (chains 2, D)
MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTE
GPLEEEEDGEELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQR
DREAGRGLGRMRRGLLYDSDEEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGH
SVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAR
EHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQL
HLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPGSCPECQSAGP
FEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN
NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFAS
IAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVS
SRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI
HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDIL
CVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVL
KKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARI
HLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLV
AEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMI
LQQF

Sequence of entity 2 (3, B, C, E), FASTA

>9LXF_2 Isoform 2 of DNA replication licensing factor MCM3 (chains 3, B, C, E)
MLPRSPPLPRGNLWWREEFGSFRAGVESSWEPPRDFGGGSSLAAGMAGTVVLDDVELREA
QRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVA
FQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCS
LVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKD
HQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSGT
FRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLAKSLAPSIHGHDYVKK
AILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYVLCTAPRAIPTTGRGSSG
VGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAK
AGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDR
EISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQDTQIYEKHDNLLHGT
KKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQDSMSSDTARTSPVTA
RTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKKRSEDESETE
DEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQ
KVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDD
NQVMVSEGIIFLI

Sequence of entity 3 (4, F), FASTA

>9LXF_3 DNA replication licensing factor MCM4 (chains 4, F)
MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQ
SPAAQDVLFSSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGS
AQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKE
EENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMA
VNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQ
EAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPED
MPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIH
YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGI
LLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSA
VGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAK
AGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDR
RLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKI
GSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGI
VDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMF
EEALRALADDDFLTVTGKTVRLL

Sequence of entity 4 (5, H), FASTA

>9LXF_4 DNA replication licensing factor MCM5 (chains 5, H)
MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELK
RHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEV
LQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLT
NIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGE
MPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQ
VDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGG
SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMR
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNS
RCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLH
VSALTQTQAVEGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDS
ALLASIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDATLSGTLSGV
EGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGE
IQHRMQRKVLYRLK

Sequence of entity 5 (6, G), FASTA

>9LXF_5 DNA replication licensing factor MCM6 (chains 6, G)
MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNT
LVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNIC
RNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGD
KCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH
LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEY
CRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRL
THYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED

Sequence of entity 6 (7, A), FASTA

>9LXF_6 DNA replication licensing factor MCM7 (chains 7, A)
MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDP
ELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVR
SPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVA
TYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEH
SDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEA
HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVG
GVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR
DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNA
RCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYV
HQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATY
TSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADV
IFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	4

Primary citation

Structures of DNA-unbound human MCM. Liu, Y., Gao, H., Yu, H. To be published.

Other PDB entries of the same protein (UniProt P49736 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YA7 1.67 Å, Cdc7-Dbf4 bound to an Mcm2-S40 derived bivalent substrate
7CIZ 1.8 Å, Crystal structure of DNAJC9 HBD helix2 in complex with H3.3-H4 dimer and MCM2 HBD
5BNX 2.31 Å, Crystal structure of Human MCM2 HBD and ASF1b chaperoning a histone H3.3-H4 dimer
5JA4 2.42 Å, Crystal structure of human TONSL and MCM2 HBDs binding to a histone H3-H4 tetramer
7CJ0 2.5 Å, Crystal structure of DNAJC9 HBD in complex with H3.3-H4 dimer and MCM2 HBD
7W1Y 2.59 Å, Human MCM double hexamer bound to natural DNA duplex (polyAT/polyTA)
9E2Z 2.6 Å, Cryo-EM structure of human CMG helicase stalled at G4-containing DNA template
5BNV 2.79 Å, Crystal structure of Human MCM2 HBD chaperoning a histone H3-H4 tetramer
7PLO 2.8 Å, H. sapiens replisome-CUL2/LRR1 complex
8W0F 2.8 Å, Cryo-EM structure of a human MCM2-7 double hexamer on dsDNA
4UUZ 2.9 Å, MCM2-histone complex
5BO0 2.91 Å, Crystal structure of Human MCM2 HBD and ASF1b chaperoning a histone H3.2-H4 dimer

Browse structure collections

About this viewer

MolViewer shows 9LXF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.