9MQO: BCMA

Crystal structure of BCMA in complex with CA10v2 Fab. Determined by X-ray diffraction at 3.18 Å resolution. Released 14 Jan 2026.

Method: X-ray diffraction
Resolution: 3.18 Å
Organism: Homo sapiens
Chains: 18
Atoms: 20,814
Mol. weight: 330.61 kDa
Released: 14 Jan 2026

Explore 9MQO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MQO contains 79 α-helices and 287 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, D and J: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	12-15	4	1
β-strand	20-23	4	1
α-helix	24-28	5
α-helix	35-41	7

Chains B and E: 5 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	2
β-strand	11-12	2	3
β-strand	18-25	8	2
β-strand	34-39	6	4
β-strand	46-51	6	4
β-strand	58-60	3	4
β-strand	68-73	6	2
α-helix	74-76	3
β-strand	78-83	6	2
α-helix	88-90	3
β-strand	92-98	7	4
β-strand	99-100	2	5
β-strand	101	1	1
β-strand	111-112	2	5
β-strand	119-121	3	4
β-strand	122-123	2	3
β-strand	132-136	5	6
β-strand	148-157	10	6
β-strand	162-166	5	7
α-helix	167-169	3
β-strand	171	1	7
β-strand	176-177	2	6
α-helix	178-180	3
β-strand	181-182	2	6
α-helix	183	1
β-strand	188-196	9	6
β-strand	201	1	8
β-strand	204	1	8
β-strand	206-212	7	7
β-strand	217-223	7	7

Chains C, I, L, O and R: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	9
β-strand	9-11	3	10
β-strand	19-22	4	11
β-strand	23-24	2	9
α-helix	31-33	3
β-strand	36-40	5	10
β-strand	47-48	2	10
β-strand	64-69	6	11
β-strand	72-77	6	11
α-helix	82-84	3
β-strand	86-93	8	10
β-strand	98-100	3	10
β-strand	104-107	4	10
β-strand	113	1	12
β-strand	116-120	5	13
α-helix	121-123	3
α-helix	124-128	5
β-strand	131-141	11	13
β-strand	142	1	12
β-strand	147-152	6	14
β-strand	155-156	2	14
β-strand	163-165	3	13
α-helix	166-169	4
β-strand	175-184	10	13
α-helix	185-189	5
β-strand	193-199	7	14
β-strand	208	1	14
β-strand	211-212	2	14

Chain F: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	23
β-strand	9-11	3	24
β-strand	19-22	4	25
β-strand	23-24	2	23
α-helix	31-33	3
β-strand	36-40	5	24
β-strand	47-48	2	24
β-strand	64-69	6	25
β-strand	72-77	6	25
α-helix	82-84	3
β-strand	86-93	8	24
β-strand	98-100	3	24
β-strand	104-107	4	24
β-strand	113	1	26
α-helix	114-115	2
β-strand	116-120	5	27
α-helix	121-123	3
α-helix	124-128	5
β-strand	131-141	11	27
β-strand	142	1	26
β-strand	147-152	6	28
β-strand	155-156	2	28
β-strand	163-165	3	27
α-helix	166-169	4
β-strand	175-184	10	27
α-helix	185-189	5
β-strand	193-199	7	28
β-strand	208	1	28
β-strand	211-212	2	28

Chains G, M and P: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	12-15	4	29
β-strand	20-23	4	29
α-helix	24-27	4
α-helix	35-41	7

Chain H: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	30
β-strand	11-12	2	31
β-strand	18-25	8	30
β-strand	34-39	6	32
β-strand	46-51	6	32
β-strand	58-60	3	32
β-strand	68-73	6	30
α-helix	74-76	3
β-strand	78-83	6	30
α-helix	88-90	3
β-strand	92-98	7	32
β-strand	99-100	2	33
β-strand	101	1	29
β-strand	111-112	2	33
β-strand	119-121	3	32
β-strand	122-123	2	31
β-strand	132-136	5	34
β-strand	148-157	10	34
β-strand	162-166	5	35
α-helix	167-169	3
β-strand	176-177	2	34
α-helix	178-180	3
β-strand	181-182	2	34
α-helix	183	1
β-strand	188-196	9	34
β-strand	206-212	7	35
β-strand	217-223	7	35

Chain K: 5 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	43
β-strand	11-12	2	44
β-strand	18-25	8	43
β-strand	34-39	6	45
β-strand	46-51	6	45
β-strand	58-60	3	45
β-strand	68-73	6	43
α-helix	74-76	3
β-strand	78-83	6	43
α-helix	88-90	3
β-strand	92-98	7	45
β-strand	99-100	2	46
β-strand	101	1	42
β-strand	111-112	2	46
β-strand	119-121	3	45
β-strand	122-123	2	44
β-strand	132-136	5	47
β-strand	148-157	10	47
β-strand	162-166	5	48
α-helix	167-169	3
β-strand	171	1	48
β-strand	176-177	2	47
α-helix	178-180	3
β-strand	181-182	2	47
α-helix	183	1
β-strand	188-196	9	47
β-strand	206-212	7	48
β-strand	217-223	7	48

Chains N and Q: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	56
β-strand	11-12	2	57
β-strand	18-25	8	56
β-strand	34-39	6	58
β-strand	46-51	6	58
β-strand	58-60	3	58
β-strand	65	1	56
β-strand	68-73	6	56
α-helix	74-76	3
β-strand	78-83	6	56
α-helix	88-90	3
β-strand	92-98	7	58
β-strand	99-100	2	59
β-strand	101	1	55
β-strand	111-112	2	59
β-strand	119-121	3	58
β-strand	122-123	2	57
β-strand	132-136	5	60
β-strand	148-157	10	60
β-strand	162-166	5	61
α-helix	167-169	3
β-strand	171	1	61
β-strand	176-177	2	60
α-helix	178-180	3
β-strand	181-182	2	60
α-helix	183	1
β-strand	188-196	9	60
β-strand	206-212	7	61
β-strand	217-223	7	61

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor superfamily member 17	A, D, G, J, M, P	protein	56	Homo sapiens	Q02223 (AlphaFold model)
CA10v2 Fab heavy chain	B, E, H, K, N, Q	protein	239	Homo sapiens
CA10v2 Fab light chain	C, F, I, L, O, R	protein	216	Homo sapiens

Sequence of entity 1 (A, D, G, J, M, P), FASTA

>9MQO_1 Tumor necrosis factor receptor superfamily member 17 (chains A, D, G, J, M, P)
GPMLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Sequence of entity 2 (B, E, H, K, N, Q), FASTA

>9MQO_2 CA10v2 Fab heavy chain (chains B, E, H, K, N, Q)
QVQLVESGGGVVQPGRSLRLSCAASGFTFSNFGMHWVRQAPGRGLEWVAVIWSDETNRYY
ADSVKGRFTVSRDNVKSTVYLQMNSLISEDTAVYYCARDQQYCSSDSCFTWFDPWGQGTL
VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA
VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTHHHHHH

Sequence of entity 3 (C, F, I, L, O, R), FASTA

>9MQO_3 CA10v2 Fab light chain (chains C, F, I, L, O, R)
QTVVTQEPSLTVSPGGTVTLTCASSTGTVTPSNYANWVQQKPGQAPRGLIGDNNSRPPGT
PARFSASLLGGKAALTLSGVQPEDEAEYYCALWFGNQWVFGGGTKLTVLRTVAAPSVFIF
PPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST
LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Crystal structure of BCMA in complex with CA10v2 Fab. Qiu, Y. To be published.

Other PDB entries of the same protein (UniProt Q02223 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ZFO 1.9 Å, J22.9-xi: chimeric mouse/human antibody against human BCMA (CD269)
1XU2 2.35 Å, The crystal structure of APRIL bound to BCMA
8HXQ 2.4 Å, Nanobody1 in complex with human BCMA ECD
1OQD 2.6 Å, Crystal structure of sTALL-1 and BCMA
6J7W 2.6 Å, Crystal Structure of Human BCMA in complex with UniAb(TM) VH
8HXR 2.7 Å, Nanobody2 in complex with human BCMA ECD
8QYA 2.72 Å, J22.9-FNY, fully humanized, CDR optimized Fab Fragment based on chimeric J22.9-xi IgG…
12ER 2.99 Å, Cryo-EM structure of BCMA in complex with the BCMA-targeted Fab arm of teclistamab and…
8QYB 3.09 Å, J22.9-ISY, fully humanized and CDR optimized Fab Fragment based on chimeric J22.9-xi IgG…
8QY9 3.1 Å, J22.9-H, fully humanized Fab Fragment based on chimeric J22.9-xi IgG against BCMA
12ES 3.43 Å, Cryo-EM structure of BCMA in complex with the BCMA-targeted Fab arm of linvoseltamab and…
2KN1 Solution NMR Structure of BCMA

Browse structure collections

About this viewer

MolViewer shows 9MQO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.