9N8Y: Cryo EM Structure of Full Length mGluR8

Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4 and PAM VU6005649. Determined by electron microscopy at 2.76 Å resolution. Released 9 Sept 2026.

Method: Electron microscopy
Resolution: 2.76 Å
Organism: Homo sapiens
Chains: 2
Atoms: 10,547
Mol. weight: 188.99 kDa
Ligands: A1BWG, E7P
Released: 9 Sept 2026

Explore 9N8Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9N8Y contains 75 α-helices and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 38 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	41-42	2	1
β-strand	46-52	7	1
β-strand	55	1	2
β-strand	67	1	2
α-helix	69-74	6
α-helix	75-88	14
β-strand	98-104	7	1
α-helix	109-116	8
α-helix	118-121	4
β-strand	149-152	4	1
α-helix	156-169	14
β-strand	173-175	3	1
α-helix	181-183	3
β-strand	192-194	3	1
α-helix	199-212	14
β-strand	217-223	7	3
α-helix	226-242	17
β-strand	246-253	8	3
α-helix	257-258	2
α-helix	261-269	9
β-strand	277-280	4	3
α-helix	284-296	13
β-strand	304-306	3	3
α-helix	316-318	3
α-helix	322-325	4
β-strand	329-333	5	3
α-helix	339-347	9
α-helix	359-367	9
α-helix	382-384	3
α-helix	402-423	22
α-helix	432-435	4
α-helix	439-447	9
β-strand	450-452	3	4
β-strand	458-460	3	4
β-strand	470-478	9	3
β-strand	483-492	10	3
β-strand	495	1	3
α-helix	499-501	3
α-helix	518-521	4
β-strand	524-528	5	5
α-helix	529	1
β-strand	536-540	5	5
α-helix	541	1
β-strand	545-547	3	6
β-strand	553-555	3	6
α-helix	556-557	2
β-strand	560-562	3	7
β-strand	569-571	3	7
α-helix	572-573	2
β-strand	574-575	2	8
α-helix	585-604	20
α-helix	612-617	6
α-helix	620	1
α-helix	621-625	5
α-helix	626-633	8
α-helix	635-639	5
α-helix	645-677	33
α-helix	692-716	25
α-helix	726-728	3
β-strand	738-739	2	8
α-helix	746-752	7
α-helix	754-770	17
α-helix	780-806	27
α-helix	810-843	34

Chain B: 37 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	39-42	4	9
β-strand	46-52	7	9
β-strand	55	1	10
β-strand	67	1	10
α-helix	69-74	6
α-helix	75-88	14
α-helix	97	1
β-strand	98-104	7	9
α-helix	109-120	12
β-strand	147-151	5	9
α-helix	156-166	11
β-strand	173-175	3	9
α-helix	181-184	4
β-strand	192-194	3	9
α-helix	199-212	14
β-strand	217-223	7	11
α-helix	226-242	17
β-strand	246-253	8	11
α-helix	257-258	2
α-helix	261-270	10
β-strand	277-281	5	11
α-helix	284-296	13
β-strand	304-307	4	11
α-helix	316-318	3
α-helix	322-325	4
β-strand	329-333	5	11
α-helix	339-346	8
α-helix	359-367	9
α-helix	373-377	5
α-helix	382-384	3
α-helix	400-402	3
α-helix	403-423	21
α-helix	432-435	4
α-helix	439-447	9
β-strand	450-452	3	12
β-strand	458-460	3	12
β-strand	470-475	6	11
β-strand	476-479	4	13
β-strand	482-485	4	13
β-strand	489-492	4	11
β-strand	495	1	11
α-helix	499-501	3
α-helix	518-521	4
β-strand	524-528	5	14
α-helix	529	1
β-strand	536-540	5	14
β-strand	545-546	2	15
β-strand	554-555	2	15
α-helix	556-557	2
β-strand	560-562	3	16
β-strand	569-571	3	16
α-helix	572-573	2
β-strand	574-575	2	17
α-helix	585-607	23
α-helix	612-617	6
α-helix	619-639	21
α-helix	648-677	30
α-helix	692-716	25
β-strand	722-723	2	18
α-helix	725-728	4
β-strand	738-739	2	17
β-strand	740-741	2	18
α-helix	746-752	7
α-helix	754-769	16
α-helix	780-804	25
α-helix	810-833	24
α-helix	835-843	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Metabotropic glutamate receptor 8	A, B	protein	839	Homo sapiens	O00222 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9N8Y_1 Metabotropic glutamate receptor 8 (chains A, B)
MKTIIALSYIFCLVFADYKDDDDAAAQEYAHSIRVDGDIILGGLFPVHAKGERGVPCGEL
KKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEKD
ASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNT
RYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCI
AQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIG
SDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFAEFWEENF
GCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMHKDLCPGY
IGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITNKSTEYKV
IGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYNYQ
VDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATTFVIVTFVR
YNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMCFSYAALL
TKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPHIIIDYGE
QRTLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEAKPIGFTM
YTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYIIIFHPE

Ligands and cofactors

ID	Name	Formula	Copies
A1BWG	(3P,8S)-3-(2,3-difluoro-4-methoxyphenyl)-2,5-dimethyl-7-(trifluoromethyl)pyrazo…	C16 H12 F5 N3 O	2
E7P	(2S)-2-amino-4-phosphonobutanoic acid	C4 H10 N O5 P	2

Primary citation

Structural basis of active state coupling of metabotropic glutamate receptor 8 to beta-arrestins. Marx, D.C., Huynh, K., Gonzalez-Hernandez, A.J. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-77556-3 · PubMed

Other PDB entries of the same protein (UniProt O00222 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BSZ 2.65 Å, Human mGlu8 Receptor complexed with glutamate
6BT5 2.92 Å, Human mGlu8 Receptor complexed with L-AP4
6E5V 2.95 Å, human mGlu8 receptor amino terminal domain in complex with…
9MB9 2.97 Å, Cryo-EM structure of Gi-bound GPCR
9MBC 2.97 Å, Cryo-EM structure of agonist-bound GPCR
9N8Z 2.97 Å, Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4 and PAM VU6005649, class 2
9MBA 3.14 Å, Cryo-EM structure of complex of transducer-bound GPCR
9MBB 3.25 Å, Cryo-EM structure of antagonist-bound GPCR
9MBD 3.32 Å, Cryo-EM structure of Apo-GPCR
9Y1M 3.32 Å, Cryo EM Structure of Full Length mGluR8 in Complex with Beta-Arrestin-1 Bound to Agonist…
9Y1N 6.18 Å, Cryo EM Structure of Full lengthmGluR8 Bound to Agonist L-AP4 and PAM VU6005649 in…

Browse structure collections

About this viewer

MolViewer shows 9N8Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.