9MBA: Complex of transducer-bound GPCR

Cryo-EM structure of complex of transducer-bound GPCR. Determined by electron microscopy at 3.14 Å resolution. Released 1 Oct 2025.

Method: Electron microscopy
Resolution: 3.14 Å
Organisms: Homo sapiens, Mus musculus
Chains: 6
Atoms: 20,641
Mol. weight: 341.09 kDa
Ligands: GLU
Released: 1 Oct 2025

Explore 9MBA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MBA contains 85 α-helices and 141 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	19-22	4	1
β-strand	26-28	3	2
β-strand	29	1	3
β-strand	34	1	3
β-strand	37-42	6	1
β-strand	52-63	12	4
α-helix	66-71	6
β-strand	75-85	11	4
α-helix	99-107	9
β-strand	112-117	6	1
α-helix	119-120	2
β-strand	127-129	3	4
α-helix	130-131	2
α-helix	138-139	2
β-strand	141-151	11	4
β-strand	163-168	6	4
β-strand	169-171	3	2
α-helix	180-182	3
β-strand	183-189	7	5
β-strand	196-203	8	5
β-strand	207-209	3	6
β-strand	214-222	9	5
β-strand	228-241	14	7
α-helix	247-248	2
β-strand	249-258	10	7
β-strand	262	1	7
β-strand	266-274	9	5
β-strand	288-290	3	4
β-strand	300	1	4
α-helix	301-304	4
β-strand	317-329	13	7
β-strand	341-349	9	7
β-strand	350-352	3	6
α-helix	353-356	4

Chain C: 9 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	8
β-strand	9-12	4	9
β-strand	18-22	5	9
β-strand	26-28	3	10
α-helix	33-36	4
β-strand	37-43	7	9
α-helix	51-52	2
β-strand	53-63	11	11
α-helix	66-71	6
β-strand	75-85	11	11
α-helix	99-108	10
β-strand	113-117	5	9
α-helix	124-126	3
β-strand	127-129	3	11
α-helix	138-139	2
β-strand	140-150	11	11
β-strand	164-166	3	11
β-strand	169-171	3	10
β-strand	183-188	6	12
β-strand	197-203	7	12
β-strand	207-208	2	13
β-strand	214-222	9	12
β-strand	228-241	14	14
α-helix	247-248	2
β-strand	249-258	10	14
β-strand	262	1	14
β-strand	266-274	9	12
β-strand	288-290	3	11
β-strand	300	1	11
α-helix	301-304	4
β-strand	317-329	13	14
β-strand	341-349	9	14
β-strand	350-351	2	13
α-helix	353-356	4

Chain D: 28 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	40-41	2	15
β-strand	46-52	7	15
β-strand	55-56	2	16
β-strand	66-67	2	16
α-helix	73-86	14
β-strand	98-104	7	15
α-helix	109-115	7
α-helix	117-121	5
β-strand	149-151	3	15
α-helix	156-168	13
β-strand	173-175	3	15
α-helix	182-184	3
β-strand	192-194	3	15
α-helix	199-212	14
β-strand	217-223	7	17
α-helix	226-243	18
β-strand	246-253	8	17
α-helix	262-270	9
β-strand	278-281	4	17
α-helix	286-297	12
β-strand	305-307	3	17
α-helix	316-318	3
α-helix	322-324	3
β-strand	329-333	5	17
α-helix	339-347	9
α-helix	359-367	9
α-helix	402-423	22
α-helix	432-434	3
α-helix	439-446	8
β-strand	450-452	3	18
β-strand	458-460	3	18
β-strand	471-476	6	17
β-strand	485-491	7	17
β-strand	495-497	3	17
α-helix	510-512	3
β-strand	527-528	2	19
β-strand	536-537	2	19
β-strand	574	1	20
α-helix	582-607	26
α-helix	612-617	6
α-helix	619-641	23
α-helix	647-677	31
α-helix	692-714	23
β-strand	730-731	2	21
β-strand	738	1	20
β-strand	739-740	2	21
α-helix	746-751	6
α-helix	754-769	16
α-helix	780-803	24
α-helix	812-829	18
α-helix	830-834	5
α-helix	835-841	7
β-strand	896	1	8

Chain R: 32 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	40-41	2	22
β-strand	46-52	7	22
β-strand	55-56	2	23
β-strand	66-67	2	23
α-helix	69-73	5
α-helix	74-88	15
β-strand	98-104	7	22
α-helix	109-115	7
α-helix	117-120	4
β-strand	147-150	4	22
α-helix	156-168	13
β-strand	173-175	3	22
α-helix	181-184	4
β-strand	192-194	3	22
α-helix	201-212	12
β-strand	217-223	7	24
α-helix	226-242	17
β-strand	246-253	8	24
α-helix	259-263	5
α-helix	264-269	6
β-strand	277-281	5	24
α-helix	286-296	11
β-strand	304-307	4	24
α-helix	322-325	4
β-strand	329-333	5	24
α-helix	339-346	8
α-helix	359-367	9
α-helix	383-385	3
α-helix	400-402	3
α-helix	403-423	21
α-helix	439-447	9
β-strand	451	1	25
β-strand	459	1	25
β-strand	471-478	8	24
β-strand	483-491	9	24
β-strand	495-497	3	24
α-helix	518-520	3
β-strand	575	1	26
α-helix	582-608	27
α-helix	612-616	5
α-helix	619-640	22
α-helix	642-643	2
α-helix	645-677	33
α-helix	687-688	2
α-helix	692-716	25
β-strand	730-731	2	26
β-strand	739-740	2	26
α-helix	746-770	25
α-helix	780-803	24
α-helix	809-814	6
α-helix	815-829	15
α-helix	830-834	5
α-helix	835-841	7
β-strand	894-896	3	1

Chain S: 2 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	27
β-strand	14-15	2	28
β-strand	23-29	7	27
β-strand	37-42	6	28
β-strand	49-53	5	28
β-strand	57-58	2	28
α-helix	59	1
β-strand	66-70	5	27
β-strand	74-79	6	27
β-strand	89-94	6	28
β-strand	106-108	3	28
β-strand	144	1	29
β-strand	147-149	3	30
β-strand	158-165	8	31
β-strand	171-178	8	31
β-strand	183-186	4	31
β-strand	194	1	29
β-strand	197-199	3	30
β-strand	204-206	3	30
β-strand	209	1	29
α-helix	214-216	3
β-strand	218-226	9	31
β-strand	235-236	2	31
β-strand	240-242	3	31

Chain T: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
β-strand	7-9	3	32
β-strand	13-14	2	33
β-strand	23-28	6	32
β-strand	36-41	6	33
β-strand	48-52	5	33
β-strand	56-57	2	33
α-helix	58	1
β-strand	66-69	4	32
β-strand	73-77	5	32
α-helix	83-85	3
β-strand	88-93	6	33
α-helix	101-104	4
β-strand	105-107	3	33
β-strand	144	1	34
β-strand	147-149	3	35
β-strand	158-165	8	36
β-strand	172-178	7	36
β-strand	183-186	4	36
β-strand	197-199	3	35
β-strand	204-206	3	35
β-strand	209	1	34
β-strand	218-226	9	36
β-strand	233-236	4	36
α-helix	237-239	3
β-strand	240-242	3	36

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	B, C	protein	376	Homo sapiens	P49407 (AlphaFold model)
Metabotropic glutamate receptor 8	D, R	protein	908	Homo sapiens	O00222 (AlphaFold model)
scFv	S, T	protein	244	Mus musculus

Sequence of entity 1 (B, C), FASTA

>9MBA_1 Beta-arrestin-1 (chains B, C)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIEKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNL

Sequence of entity 2 (D, R), FASTA

>9MBA_2 Metabotropic glutamate receptor 8 (chains D, R)
MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGER
GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
EIGGVSIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA
EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH
KDLCPGYIGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITN
KSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER
CEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATTF
VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMC
FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH
IIIDYGEQRTLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA
KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI
IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
ISYSNHSI

Sequence of entity 3 (S, T), FASTA

>9MBA_3 scFv (chains S, T)
MGDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV
PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGCGTKVEIGTTAASGSSGGS
SSGAEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKCLEWVASISSYYG
YTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLV
TVSS

Ligands and cofactors

ID	Name	Formula	Copies
GLU	Glutamic acid	C5 H9 N O4	2

Primary citation

Structural characterization of five functional states of metabotropic glutamate receptor 8. Zhao, J., Deng, Y., Xu, Z. et al. Mol Cell (2025) 85:3460-3473.e6. DOI 10.1016/j.molcel.2025.08.019 · PubMed

Other PDB entries of the same protein (UniProt P49407 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AS4 2.3 Å, Crystal structure of human beta-arrestin-1
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
2IV8 2.8 Å, beta appendage in complex with b-arrestin peptide
8ZYY 2.83 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
9UYN 2.9 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9LXR 3.07 Å, A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 1 conformation)
9LY2 3.1 Å, A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 1 conformation)
25GN 3.2 Å, receptor-arrestin
8AS2 3.2 Å, Structure of arrestin2 in complex with 4P CCR5 phosphopeptide and Fab30

Browse structure collections

About this viewer

MolViewer shows 9MBA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.