9O0H: PDB entry 9O0H

The ubiquitin-associated domain of human thirty-eight negative kinase 1, fused to the 3TEL crystallization chaperone via a 2-glycine linker. Determined by X-ray diffraction at 2.24 Å resolution. Released 30 Apr 2025.

Method: X-ray diffraction
Resolution: 2.24 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,470
Mol. weight: 37.6 kDa
Released: 30 Apr 2025

Explore 9O0H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9O0H contains 28 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 28 helices, 0 β-strands

Element	Residues	Length
α-helix	7-10	4
α-helix	13-15	3
α-helix	18-32	15
α-helix	34-36	3
α-helix	39-41	3
α-helix	46-49	4
α-helix	54-60	7
α-helix	65-78	14
α-helix	92-94	3
α-helix	98-100	3
α-helix	103-117	15
α-helix	119-121	3
α-helix	124-127	4
α-helix	131-134	4
α-helix	139-145	7
α-helix	150-163	14
α-helix	183-185	3
α-helix	188-202	15
α-helix	204-206	3
α-helix	209-211	3
α-helix	216-221	6
α-helix	224-230	7
α-helix	235-244	10
α-helix	248-258	11
α-helix	266-275	10
α-helix	280-295	16
α-helix	300-309	10
α-helix	314-321	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1	B	protein	325	Homo sapiens	P41212 (AlphaFold model), Q13470 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>9O0H_1 Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1 (chains B)
GSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYR
SPHSGDELYELLQHILKQRPGGGGSTSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLR
PIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRPGGGGSTSIRLPAHLR
LQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYE
LLQHILGGELQRKIMEVELSVHGVTHQEAQTALGATGGDVVSAIRNLKVDQLFHLSSRSR
ADAWRILEHYQWDLSAASRYVLARP

Primary citation

1TEL Fusions Outperform 2TEL and 3TEL Fusions in Controlled Comparisons. Samarawickrama, P., Ludlow, K., Probst, R. et al. To be published.

Other PDB entries of the same protein (UniProt P41212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DOC 1.19 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
9ZB7 1.24 Å, A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion
9Q4D 1.3 Å, A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct…
7TW9 1.41 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin
1JI7 1.45 Å, Crystal Structure of TEL SAM Polymer
7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7TW8 1.55 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH
8FRJ 1.57 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946
9DB5 1.57 Å, A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker
8FT8 1.6 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
8FRK 1.61 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158
7TW7 1.62 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM

Browse structure collections

About this viewer

MolViewer shows 9O0H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.