9OD9: Disulfide-stabilized IL-18 variant

Structure of disulfide-stabilized IL-18 variant. Determined by X-ray diffraction at 1.6 Å resolution. Released 30 Jul 2025.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,399
Mol. weight: 19.16 kDa
Released: 30 Jul 2025

Explore 9OD9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9OD9 contains 6 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	38-49	12	1
α-helix	54	1
β-strand	55-58	4	1
β-strand	64-67	4	1
α-helix	74-77	4
α-helix	78-81	4
β-strand	83-90	8	1
β-strand	96-104	9	1
β-strand	106-111	6	1
α-helix	113-115	3
β-strand	118-120	3	1
α-helix	123-125	3
β-strand	127-128	2	1
β-strand	137-142	6	1
β-strand	145-153	9	1
β-strand	159-166	8	1
β-strand	169-176	8	1
α-helix	183-185	3
β-strand	187-191	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-18	A	protein	166	Homo sapiens	Q14116 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9OD9_1 Interleukin-18 (chains A)
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDSRDNAPRTIFIISMYKDSQPRGM
AVTISVKSEKISTLSSENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSY
EGYFLCSEKERDLFKLILKKEDELGDRSCMFTVQNEDGGGENLYFQ

Primary citation

Engineered IL-18 variants with half-life extension and improved stability for cancer immunotherapy. Bainbridge, T.W., Wang, L., Moskalenko, M. et al. J Immunother Cancer (2025) 13. DOI 10.1136/jitc-2025-011789 · PubMed

Other PDB entries of the same protein (UniProt Q14116 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VXT 1.49 Å, Crystal structure of human IL-18 complexed to murine reference antibody 125-2H Fab
4EKX 1.75 Å, Crystal Structure of YLDV 14L IL-18 Binding Protein in Complex with Human IL-18
7AL7 1.8 Å, The Crystal Structure of Human IL-18 in Complex With Human IL-18 Binding Protein
9OD7 1.9 Å, Structure of disulfide-stabilized IL-18 variant
4XFS 1.91 Å, Structure of IL-18 SER Mutant I
3F62 2.0 Å, Crystal Structure of Human IL-18 in complex with Ectromelia virus IL-18 Binding Protein
4XFT 2.0 Å, Structure of IL-18 SER Mutant III
4HJJ 2.1 Å, Structure Reveals Function of the Dual Variable Domain Immunoglobulin (DVD-Ig) Molecule
3WO2 2.33 Å, Crystal structure of human interleukin-18
4EEE 2.71 Å, Crystal Structure of YLDV 14L IL-18 Binding Protein in Complex with Human IL-18
4R6U 2.8 Å, IL-18 receptor complex
4XFU 2.85 Å, Structure of IL-18 SER Mutant V

Browse structure collections

About this viewer

MolViewer shows 9OD9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.