The Structure of Porcine Trypsin in Complex with Crystallization Additives I. Determined by X-ray diffraction at 1.28 Å resolution. Released 27 May 2026.
Explore 9PD9 in 3D Show helices and sheets RCSB PDB PDBe
9PD9 contains 9 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 1 |
| β-strand | 5-6 | 2 | 2 |
| α-helix | 7-8 | 2 | |
| β-strand | 15-19 | 5 | 3 |
| β-strand | 23-31 | 9 | 3 |
| β-strand | 34-37 | 4 | 3 |
| α-helix | 39-41 | 3 | |
| β-strand | 47-50 | 4 | 3 |
| β-strand | 54 | 1 | 4 |
| β-strand | 63-72 | 10 | 3 |
| β-strand | 86-90 | 5 | 3 |
| α-helix | 93-96 | 4 | |
| β-strand | 97 | 1 | 5 |
| β-strand | 100 | 1 | 5 |
| β-strand | 104 | 1 | 2 |
| α-helix | 105-106 | 2 | |
| α-helix | 109-111 | 3 | |
| β-strand | 115-120 | 6 | 2 |
| β-strand | 134 | 1 | 4 |
| β-strand | 136-142 | 7 | 2 |
| α-helix | 143-144 | 2 | |
| α-helix | 145-151 | 7 | |
| β-strand | 160-163 | 4 | 2 |
| β-strand | 171 | 1 | 1 |
| β-strand | 180-183 | 4 | 2 |
| β-strand | 186-193 | 8 | 2 |
| β-strand | 204-208 | 5 | 2 |
| α-helix | 209-211 | 3 | |
| α-helix | 213-222 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Trypsin | A | protein | 231 | Sus scrofa | P00761 (AlphaFold model) |
>9PD9_1 Trypsin (chains A) FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGE HNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAA GTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDS CQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1CHW | 4-aminobenzene-1-sulfonic acid | C6 H7 N O3 S | 1 |
| OXM | Oxamic acid | C2 H3 N O3 | 6 |
| OXL | Oxalate ion | C2 O4 | 1 |
| PG5 | 1-methoxy-2-[2-(2-methoxy-ethoxy]-ethane | C8 H18 O4 | 4 |
| BEN | Benzamidine | C7 H8 N2 | 4 |
| CA | Calcium ion | Ca | 1 |
| PG6 | 1-(2-methoxy-ethoxy)-2-{2-[2-(2-methoxy-ethoxy]-ethoxy}-ethane | C12 H26 O6 | 3 |
Water and common crystallization additives (PEG, PG4) are not listed.
X-ray Diffraction Analyses of Trypsin Crystals Grown in the Presence of Additives. McPherson, A. Cryst Growth Des (2026) 26:352-364. DOI 10.1021/acs.cgd.5c01305
Other PDB entries of the same protein (UniProt P00761 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9PD9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.