9PQD: Alpha-2A adrenergic receptor

Locally-refined structure of alpha2a adrenergic receptor in complex with Go heterotrimer, scFv16, and compound Z7149. Determined by electron microscopy at 3.29 Å resolution. Released 20 Aug 2025.

Method: Electron microscopy
Resolution: 3.29 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,058
Mol. weight: 53.86 kDa
Ligands: A1CIZ
Released: 20 Aug 2025

Explore 9PQD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9PQD contains 19 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 19 helices, 0 β-strands

Element	Residues	Length
α-helix	46-73	28
α-helix	82-85	4
α-helix	86-100	15
α-helix	102-106	5
α-helix	107-111	5
α-helix	122-132	11
α-helix	136-144	9
α-helix	148-151	4
α-helix	153-156	4
α-helix	157-159	3
α-helix	162-180	19
α-helix	209-216	8
α-helix	217-221	5
α-helix	222-242	21
α-helix	383-401	19
α-helix	403-414	12
α-helix	424-431	8
α-helix	437-443	7
α-helix	446-455	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-2A adrenergic receptor	R	protein	491	Homo sapiens	P08913 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>9PQD_1 Alpha-2A adrenergic receptor (chains R)
MKTIIALSYIFCLVFADYKDDDDASIDFRQEQPLAEGSFAPMGSLQPDAGNASWNGTEAP
GGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFTSRALKAPQNLFLVSLASAD
ILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAI
EYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVIS
SCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSA
GPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSDHAERPPGPRRPERGPRGKG
KARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKASRWRGRQNREKRFTFVLAVV
IGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKK
ILCRGDRKRIV

Ligands and cofactors

ID	Name	Formula	Copies
A1CIZ	(6M)-1-methyl-6-(1,2,5,6-tetrahydropyridin-3-yl)-1H-indole	C14 H16 N2	1

Primary citation

Large Library Docking for Polypharmacology. Wu, Y., Vigneron, S., Braz, J. et al. J Med Chem (2026) 69:6210-6229. DOI 10.1021/acs.jmedchem.5c03810 · PubMed

Other PDB entries of the same protein (UniProt P08913 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KUX 2.7 Å, Crystal structures of the alpha2A adrenergic receptor in complex with an antagonist RSC.
9CBL 2.8 Å, Cryo-EM structure of epinephrine-bound alpha-2A-adrenergic receptor in complex with…
9PLN 2.8 Å, Locally-refined structure of alpha2a adrenergic receptor in complex with Go…
9PLO 2.8 Å, Structure of alpha2a adrenergic receptor in complex with Go heterotrimer, scFv16, and…
7EJ8 3.0 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex bound to brimonidine
6KUY 3.2 Å, Crystal structure of the alpha2A adrenergic receptor in complex with a partial agonist
7EJ0 3.2 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex
9CBM 3.2 Å, Cryo-EM structure of dexmedetomidine-bound alpha-2A-adrenergic receptor in complex with…
7EJK 3.4 Å, Structure of the alpha2A-adrenergic receptor GoA signaling complex bound to oxymetazoline
7W7E 3.4 Å, Cryo-EM structure of the alpha2A adrenergic receptor GoA signaling complex bound to a…
9IQR 3.4 Å, Cryo-EM structure of MT3-alpha2AAR
7W6P 3.47 Å, Cryo-EM structure of the alpha2A adrenergic receptor GoA signaling complex bound to a G…

Browse structure collections

About this viewer

MolViewer shows 9PQD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.